KEGG   Breviolum minutum: v1.2.027718.t1Help
Entry
v1.2.027718.t1    CDS       T04349                                 

Gene name
symbB.v1.2.027718.t1
Definition
(OIST) -
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:smin03019]
    v1.2.027718.t1 (symbB.v1.2.027718.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     v1.2.027718.t1 (symbB.v1.2.027718.t1)
Messenger RNA biogenesis [BR:smin03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     v1.2.027718.t1 (symbB.v1.2.027718.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DHHC
Motif
AA seq 557 aa AA seqDB search
HLEHARELFKKWGFRRIEDICWVKTNRQAPLDTRGSVKQQSVMYGDSSIIQRTKEHCLVG
VKGTVKRSVDTHFIHANCDVDLIMEEEKSFGSTHKPIELYETIEHFCLGRRRLELFGRDR
NLRDGWLTLGNGLTTDNWDKETYLKWFEGDIQWPEAKDFKGGKLLGSVAEIETLRPKSPV
RPGRKRSRSLSPRRRTAGGIGAAALQSQSALAPTLLASRATPPNVEPAKPAEREEAEIES
ESSDSQQEQGRNGDCIYFGWDFTPYLPYLLSCSTVLGGTGMFVIQVPLLATNTFIPQVWI
MATFATLYAITFGCMSYAAFVDPGQVPGDGGSFDVEKGMPLRAHKSWQYPQPVRRYDHFC
RWINNTIGLHNHREFVIMVCTLLLIAFLGMGVDLVLLSSFLGTIASQSFPPNEIVSMVLV
ALHLGYCFALLALAGPILRIHVGLISRNELAQEWKKNTHYVANTSMGDNVPVRDIQDVDE
YNELFARDAFVYDGTRNPFDRGTWRNCLVFWCAPRPSTGAGGWRAARASRDYEYEEDEKP
LPEDLGEMAPPIPKEDD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gcacctggaacatgcacgagagctcttcaagaagtggggctttcgacggatcgaggacat
ttgctgggtcaaaacgaaccggcaagcgccgttggatacccgtggctctgtgaagcaaca
aagcgtcatgtatggcgattcttcgattatccaacggaccaaagaacattgcctcgttgg
ggtgaagggtacggtgaaacgatccgtggacacacacttcatccatgccaactgtgatgt
ggatctcatcatggaggaagagaagagttttggttctacacataagccaattgagcttta
tgaaaccatcgaacatttttgcctcggtcgaaggcgtttggaactttttggtcgcgatcg
caaccttcgtgacggatggctgaccttgggcaatggcctcaccactgataattgggacaa
agagacctacctcaagtggtttgagggtgacatccaatggcccgaggctaaagacttcaa
gggcggcaaattgcttgggagcgtggcggagattgaaaccttgaggccaaagagcccagt
gagaccaggtcgcaaacgttccagatccttgtcgccacggagacggacggctggtggcat
tggggctgccgccctccagagccagtcagctctggcgcccacattgctcgcttccagagc
tacccctccaaatgtggagcccgcaaagcctgcagagcgagaggaggcggagatcgaaag
tgaatcttctgattcacaacaagaacaaggtcgcaatggcgactgcatatattttggttg
ggattttaccccataccttccatatttactgtcttgctcgacagtattgggtggcaccgg
aatgtttgtcatccaagtgccgttgctggccaccaacaccttcatcccacaagtgtggat
catggccacattcgcaacactgtatgctatcaccttcgggtgcatgtcgtatgcagcctt
tgtggatcctggccaagtccctggtgatggtggcagtttcgacgtcgagaaaggaatgcc
actgcgggctcacaagtcctggcagtatcctcagccagttcggcggtatgaccacttctg
caggtggatcaataataccattggcctgcacaaccaccgtgagttcgtgatcatggtgtg
cactttgctgctcattgcttttctgggaatgggcgtcgatttggtgttgctatcttcttt
tcttgggactatagcttcacaaagtttcccaccaaatgagattgtttcaatggtgctggt
agcgctgcatcttgggtattgctttgccctcttggcgcttgcaggaccaatattaaggat
ccacgtgggattgatttcacgaaacgagttggcccaggagtggaagaagaacacacatta
cgtcgccaacactagcatgggcgacaatgttccagtgagggacatccaagatgtcgatga
gtacaacgagctcttcgcaagagatgccttcgtatacgatggcaccaggaatcctttcga
ccgggggacctggagaaactgtttggtgttttggtgtgcgccccgtcccagcaccggagc
gggtggatggagagcagcgcgtgcctccagggattacgagtacgaggaagacgaaaagcc
tcttcctgaagatttgggtgaaatggcgcctcctattccaaaggaagatgactgatgcgg
gccgagctgaagatctgc

DBGET integrated database retrieval system