KEGG   Breviolum minutum: v1.2.029520.t1Help
Entry
v1.2.029520.t1    CDS       T04349                                 

Gene name
symbB.v1.2.029520.t1
Definition
(OIST) -
  KO
K21682  pyruvate dehydrogenase (NADP+) / aquacobalamin reductase (NADPH) [EC:1.2.1.51 1.16.1.5]
Organism
smin  Breviolum minutum
Pathway
smin00860  Porphyrin and chlorophyll metabolism
smin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    v1.2.029520.t1 (symbB.v1.2.029520.t1)
Enzymes [BR:smin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.51  pyruvate dehydrogenase (NADP+)
     v1.2.029520.t1 (symbB.v1.2.029520.t1)
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.5  aquacobalamin reductase (NADPH)
     v1.2.029520.t1 (symbB.v1.2.029520.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POR_N FAD_binding_1 POR Flavodoxin_1 EKR NAD_binding_1 PFOR_II Fer4_6 Fer4_9 Fer4_10 Fer4_16 Fer4_21 Fer4_7 TPP_enzyme_C Fer4 Fer4_8 Fer4_4 Fer4_2 Transketolase_C Fer4_17
Motif
AA seq 1830 aa AA seqDB search
MALRGQTAPFGPYGGLCLQFLNRGQDRQEETAERLEPLGAGSGAADIEYEQFMKAKEVQR
AMFQAENKTIVHQCADTDIIEAAQGSVACIDGNQAAAHVAYAFSDCAFIYPITPSSPMGE
MVDEWAAQGLINCYGQKLSVTEMQSEAGAAGALHGALKAGAFSTTFTASQGLLLMIPNMY
KIAGELLPCVMHVAARALAGQALSIFGDHSDVMACRSTGWAMLASESVEMAQVNAIVSHL
VSMERRVPVQHFFDGFRTSHEVNKVKLIDYNTMKTFINWEAVKEHHDLAMNPRHPHVQGT
SQGPDIFFQCVEAGNSFYDGLADLFEEKGKMIAEKTGLHFALYGYEGHPEAKHVIVVMGS
GAITCGETANFLAKTKGQRVGVLKVRLFRPWDSSRFLAALPKTTERICVLDRTKEQGSQG
EPLLLEVTSMLQLSAHNEIVVVGGRYGLGSKEFTPNMVLSIYENLAKENPKPRFTVGIND
DVTFLSLPVGPWLNVLPEGTTECMFYGLGSDGTVGANKSAVKMIALGTELHAQAYFEYDA
KKSGGVTISHLRFGPKPIHAPYNVRAADYLAVHKQSYVHSYDMTRYLKQNAVFVINCSWD
KSEIEKQLPAKMRKDLAEKKAKLFIIDATKIAVKAGLGKRINMIMQTVFFKLSAVMPYEE
AVEMLKKSIKKMYGKKGDKVVKMNIDGVDASIEGIVQVDIPASWASLSVEGEATDAAKQK
VAYGKGPRMFPEVQDAAQFAKQVQSPCNNLDGNALPVSAFVPGGRVPLGTSQYEKRGIAI
NVPRVDMDKCTQCNKCSLICPHAAVRPFLASGQELAKAPAAFKAGSRAAIGGGVLDNYQY
RIQVSPWDCTGCELCVRICPADALSLGPAEKVIEEEEPNWNFAITLPDRGDEIDKTTVKG
SQFQKPYLEFSGACEGCGCSSIWGGSNPSFPYTINSKGEGPAWANSLFEDNAEFGFGMRK
AFKQRRDYLAMQVEDTLNDKAVTMSDELRQALNQFLENMHDLLLPKGRSIYHQIMEKLVP
LLEKEKGNHVKIHGLYDLEDMFGRSSFWIVGGDGWAYDIGYGGLDHVIASEEHVNILVLD
TEMYSNTGGQASKATPKGAMAKFAEGGKLTQKKDMGQLAMTYKNVYVASICVHVNPQQAV
RAMIEADAYPGPSIILAYSPCISQGFPMAESIQHCQMAVDSGYWPLYRYNPDAAAHGNNP
FQLDSRKIKGDLFKFLAKENRFAAVMRRDPKHAEELDNKLQENLVQKNHLLQVLNKEDLE
GQFSKLVEGLSDAKSSDNSITVLYGSESGNAEEQAKNLMQDLIARGLKATVSSLDDFEFE
ELPNQKIMILVVSTCGLGEYPANCKQTWLKLQSQDLPMSWLSGVKFCVFGLGDSTYSQFC
VAAAGFDTRLGELGGQRMLKRGVGDDRDEDRYYTGWEAWLPELWKVLGAPALPLSQDIPA
PSYRVDASAGTLEKPPVKDDDIIPPGANRLTLLTNNVLTGDAKYDRDIRHYEFKIEGTNM
MGFDPAQNLRVLPLEGARNWCPTELSVRQLFSHVLDIFGKPNRKFYQTLALFAKDEGEKK
QLQSIVENSAEGAALYRDMTHDFAHHADVFKKFSSARPPIEHLLQMMPVLKPRSYSIASS
PLMHPDKIQLCVVLVDWTVETTNELRLGECTGYMQQQKPGAQIMCAVRSSAIVLPTEPQK
PVIMAGMGTGLAPWRAVTQERVMQKRQGLDVGKCMLFFGARYKQEWLYREEFERYEQEGV
LQMHTAFSREQARKIYVQHRIVEAGNDVAQKMLNEGGHFYVCGSARQVPEDIYTAMKEVM
MAHERCGEEDAEAILSNLKMEGRYTVEAWS
NT seq 6084 nt NT seq  +upstreamnt  +downstreamnt
gtgctagtgattgacgcaactagtaatggcgctccgtggacagacagctccttttggacc
ttatggaggtctttgccttcagtttctgaatcgaggtcaagatcgtcaagaagagaccgc
agaacgtttggagccccttggagcagggtccggtgcagcagacatcgaatacgagcaatt
tatgaaagccaaggaagttcaaagggctatgttccaagctgagaacaagaccattgtgca
tcaatgtgccgacaccgacatcatcgaagctgctcagggatctgtggcatgcattgatgg
gaatcaagctgcagctcacgttgcctatgccttcagtgactgtgccttcatctatcccat
cacgccaagttctcccatgggagagatggtggacgagtgggccgcacaaggcctcatcaa
ctgctacggacagaagttgagtgtcacggagatgcaaagcgaagctggtgccgcgggcgc
cttgcatggtgccctgaaggcaggagcgttcagcactaccttcacagccagtcagggttt
gctattgatgatccccaacatgtacaagattgctggcgagttgctcccttgcgtcatgca
tgtggctgctcgtgctttggcgggacaggcgctgtctatctttggagatcacagtgatgt
gatggcctgtcgttccacaggctgggccatgctggcttctgaatctgtggagatggcaca
ggtgaacgccatcgtgtcccacctcgtttcaatggaacgtcgtgttcctgtgcagcactt
ctttgatggtttccgtacgagtcacgaggtgaacaaggtcaagctgattgactacaacac
catgaagacattcatcaattgggaagcagtcaaggagcaccacgatttggcaatgaaccc
tcgccatcctcatgtgcagggcacttcacaaggtcctgatatcttcttccagtgcgtgga
ggctggcaacagcttctatgatggattggctgatctctttgaagagaaaggaaagatgat
tgcagagaagacaggtttgcactttgctctttatggatatgaaggacacccagaggcaaa
acacgtaatcgtggtcatgggcagcggagcaatcacttgcggagagaccgcaaacttctt
ggcaaagacaaagggacaacgtgttggcgtgttgaaggtccgtctcttccgcccatggga
cagttcccgattcttggctgccttgccaaagaccactgagcgcatttgcgttttggatcg
taccaaagagcagggctcgcagggtgagccactgctgttggaggtcacttctatgttgca
gctgagtgctcacaacgaaattgttgtggtcggaggccgctatggtcttggttccaagga
gttcacgcccaacatggtgctttccatctatgagaacctggccaaggagaaccccaagcc
acgcttcactgtgggtatcaacgatgatgtgacattcttgtctttgcctgttggcccatg
gctcaacgtgcttccagaaggcaccaccgagtgcatgttctacggactgggaagtgatgg
cactgtgggtgccaacaagagcgcagtgaagatgattgcattgggaactgagcttcatgc
ccaggcctacttcgagtatgacgccaagaagagtggtggtgtcaccatcagccaccttcg
tttcggtcccaagcccatccatgcgccatacaacgtgcgtgcagcagactacctggccgt
tcacaagcagagctacgtgcacagctatgacatgacacgatacttgaagcagaacgcggt
ctttgtcatcaactgctcctgggacaagagcgagattgagaaacagctgcccgccaagat
gcgcaaggatttggctgagaagaaggccaagctcttcattatcgatgcgaccaagattgc
tgtgaaggctggactgggaaagcgtatcaacatgatcatgcagaccgttttcttcaagct
cagtgcggtgatgccatacgaagaagcggtggagatgttgaagaagagcatcaagaagat
gtacggtaagaagggcgacaaagtggtgaagatgaacatcgatggtgtggatgcctccat
cgaaggcattgtgcaagtggacatccctgcatcctgggcttccttgtcagtggagggaga
ggccaccgacgccgcgaagcagaaggtggcctacggcaagggcccacgcatgttcccaga
agtgcaggatgcagcgcagttcgccaagcaggtgcagtcaccatgcaacaacttggatgg
caatgcgcttccggtaagtgcttttgtgccaggtggccgtgtcccacttggtactagtca
gtatgagaagcgtggtattgccatcaatgtgccacgtgttgacatggacaagtgcactca
gtgcaacaagtgcagtctcatttgcccccatgcagcagttcgaccattcctggcttctgg
acaagagctggcaaaggcaccagctgctttcaaggcgggtagccgtgctgccattggtgg
tggcgtcttggacaactatcagtaccgcatccaggtttccccatgggattgcactggctg
cgagttgtgtgtgcgcatttgccctgctgatgcactttctttgggacctgcagagaaggt
gattgaagaagaggaaccaaattggaactttgcaatcactctcccagatcgtggtgatga
gattgacaagaccactgtgaagggctcccagttccagaaaccttacttggagttcagcgg
tgcttgcgaaggatgcggctgctcttccatttggggcggctccaatccatccttccccta
caccatcaatagcaagggagagggtcccgcttgggccaactccttgttcgaggacaatgc
ggagttcggtttcggcatgcgcaaggccttcaaacaacgtcgggactacctggccatgca
agtcgaggacacgctgaacgacaaggcggtcaccatgtcagatgagttgcggcaagcgct
gaaccagttcctggagaacatgcacgacttgcttttgcccaaaggacgtagcatctacca
ccagattatggaaaaactcgtgcctctgttggagaaggagaagggcaatcatgtgaagat
ccacggcctgtacgacttggaagacatgtttggccgcagcagcttctggattgttggcgg
agatggctgggcgtacgatattggctatggtggtttggatcatgtcattgccagtgagga
gcatgtgaacatcctggtgcttgacacagagatgtacagcaacactggtggacaggcatc
caaagcaacaccaaagggagccatggcgaaatttgctgagggcggcaagctgacgcagaa
gaaggacatgggacagttggctatgacctacaagaacgtctacgtggccagcatttgcgt
gcatgtgaacccacagcaggcagtgagagccatgattgaggcagatgcctatcctggacc
cagcatcattcttgcctacagcccatgcatcagtcaaggcttcccaatggctgaatctat
tcagcactgccagatggctgtggacagtggatattggccactgtaccgctacaatcctga
tgctgcagcccatggcaacaatccattccagcttgacagccgcaagatcaagggtgatct
cttcaagttcctggccaaggagaaccgcttcgcagcagtgatgcgccgagaccctaagca
tgcagaggagctggacaacaagctgcaggagaatttggttcagaagaatcacttgcttca
ggtcctgaacaaggaagacttggagggccagttcagcaaattggtggaaggtctttcaga
tgcaaagagctctgacaattccatcaccgtgctctatggcagtgagagtggcaacgcaga
ggagcaagccaagaacttgatgcaagacctgattgctcgcggtttgaaggccacagtgag
ctcactggatgacttcgagtttgaggagctgccaaaccagaagattatgatcttggttgt
ctccacctgcggattaggagagtatccagccaactgcaagcagacttggctgaagcttca
gtcccaggatttgccaatgtcctggctgtcaggtgtgaagttctgtgtctttggtttggg
tgactcaacatacagccagttctgcgtggcagcagccggcttcgacacacgtctgggcga
gcttggtggtcagcgcatgctgaagcgtggtgttggtgatgaccgtgatgaggaccgcta
ctacactggctgggaagcatggctgccagagctttggaaggtgctaggagccccagctct
gccattgagccaagacatcccagcaccatcctatcgcgtggatgcatctgcaggcacttt
ggagaagccacctgtgaaggatgatgacatcatcccacctggtgccaacagactcacctt
gttgaccaacaacgtgctgactggtgatgccaagtatgacagagacattcggcactatga
gttcaagattgaaggcaccaatatgatgggctttgaccctgcacagaacctcagagtcct
tcctttggagggagcccgcaactggtgccccactgagttgagtgtgcgacagcttttctc
tcatgtcttggacatctttggaaagcccaaccgcaagttctaccagactttggccctctt
tgccaaggatgagggtgagaagaagcagctgcagagcattgttgagaacagcgcagaggg
agctgccctgtatcgtgacatgacacatgactttgctcatcatgcggatgtgttcaagaa
gttctcaagcgcaaggcctcctatcgagcacttgttgcagatgatgccagtgctgaaacc
caggagctattccatcgccagctctcccttgatgcatcccgacaagatccagctttgcgt
ggtgttggttgactggacggtggaaaccaccaacgaacttcgattgggtgaatgcacagg
gtatatgcaacagcagaaacctggagctcagatcatgtgcgctgttcgctcaagtgccat
tgtgttgcctacggagccgcagaaaccagtgatcatggcaggaatgggcaccggcttggc
accatggcgtgctgtgacacaggagcgagtgatgcagaaacgccagggcctggacgttgg
aaagtgcatgctctttttcggcgcccggtacaagcaggaatggctctaccgtgaagagtt
tgaacgctacgagcaggagggtgttctccagatgcacacagccttctcccgagagcaggc
acgcaagatttatgtgcagcaccgcatcgtggaggctggcaacgatgtggcccaaaagat
gttgaacgagggaggccacttctacgtctgcggctcagcacgacaagtacctgaagacat
ctacaccgcaatgaaagaggtgatgatggcacatgaacgttgtggagaggaggatgctga
agcgattttatcaaatttgaagatggagggacgttacacggtggaagcttggtcctgaga
aggcagcttctttttgatgggagctttggagggcctaacttctgaagggctcctttgaat
caaattgcatgtagatagtttcgagacatttccaacaaaggcttgtgcttctagatataa
acaaaaggtgatttgaaacactttgagacatcaaggtataaatagaacaaagagatcaca
aggtgttttcgaagcatgaagtggaaagaccattttgaaagaagcatagcctcaggggca
aataattggctccatcgttttcgtcgtcctccggcagggagtattttgcggcgaaagcaa
ttggggaaacgacttgggcagatcaatctcgaattttcatcatccaaaaaaacgttcagt
acaacgttcttgaaaaagtttgtttccatttgcaatactccatcttcccaagtccagccc
tttcatattttttcaatacatatcaaggcatttgatatatgttggttgaaagtcctgttg
agggaagatttggctcacaggcactcctggtgattatctcgacctgccccgagcatcagc
gaaaactaaaattcctcaaaaaat

DBGET integrated database retrieval system