KEGG   Breviolum minutum: v1.2.031107.t1Help
Entry
v1.2.031107.t1    CDS       T04349                                 

Gene name
symbB.v1.2.031107.t1
Definition
(OIST) -
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
smin  Breviolum minutum
Pathway
smin04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:smin00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    v1.2.031107.t1 (symbB.v1.2.031107.t1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smin01001]
    v1.2.031107.t1 (symbB.v1.2.031107.t1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smin03036]
    v1.2.031107.t1 (symbB.v1.2.031107.t1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smin04147]
    v1.2.031107.t1 (symbB.v1.2.031107.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     v1.2.031107.t1 (symbB.v1.2.031107.t1)
Protein kinases [BR:smin01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   v1.2.031107.t1 (symbB.v1.2.031107.t1)
Chromosome and associated proteins [BR:smin03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     v1.2.031107.t1 (symbB.v1.2.031107.t1)
Exosome [BR:smin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   v1.2.031107.t1 (symbB.v1.2.031107.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like APH YrbL-PhoP_reg RIO1
Motif
AA seq 270 aa AA seqDB search
METDLHRVIYSKQVLNDEHHQYFSYQILRGLLYLHSANVVHRDLKPANILVNKNCDLKIC
DFGLARGLGNDEDDPTLTDYVVTRWYRAPEVVLLASEYTKSIDVWSVGCILCELIGRKPI
FTGKDHLDQIKRILVVLGTPTEDDLAWLPPRSPARNFIKKVPPATKQNWKSIYPKATDAG
IEAIEKMLTFNPTKRATIAECMVLRYYETLHMPDDEPVAEVPVDWAFDKFTPTKRNLQNY
IYAECWKFHPEIAQRDAKFLDSREITPLLK
NT seq 1321 nt NT seq  +upstreamnt  +downstreamnt
tggtttcaagaaaactgggccttgtttgcggttcggcccgcagaggcgccatttggcaat
gccacccacagcttggaaggaagtggtcatcgatggcaaggtgaagtttaaggtgcctgc
tcatcttgaactcatcaagaaggtgggctctggagcatatggcactgtggcttcgtttca
agacccaaagaccgggacgaagttagcagtaaaaaagattacggatgccttccatgatct
ggtggatggcaagcgaatcttgagggaggtgaagcttttgcgaagcttcaggcatgacaa
tatcatcagcattctggacatgtatccaccagaacatccggacttcgatgacatttacat
tgtcacggatctgatggagacagatctgcatcgtgtcatctactcgaaacaggtcttaaa
tgacgaacaccatcagtacttctcctaccaaattctgcgaggcttgctgtatttacatag
tgccaatgtggtgcatcgcgacctgaaaccagcaaacattttggtgaacaaaaattgcga
cctgaagatttgcgacttcggtttggcacgaggcctcggcaatgatgaggatgatcccac
cctgacggactatgtggtcaccagatggtatcgtgctccagaggtagtgctcctggcatc
ggagtacaccaaatccatcgacgtgtggtcagtaggttgcatcctttgcgagttgattgg
ccgaaaacctatcttcaccggaaaggatcatttggaccagattaagaggattttggtcgt
gctaggcacacctacggaggacgatttggcgtggctgccgccacgcagtcctgcgaggaa
cttcatcaagaaggtaccgcctgcaaccaaacagaactggaaatccatctatccgaaggc
aacagatgctggaattgaggcaattgagaagatgttgactttcaaccccaccaagagggc
cacgattgccgaatgcatggtgttacggtattatgaaactttacatatgccagacgacga
gccggtggcagaggtgccggtcgactgggccttcgacaagttcacaccgaccaaaagaaa
tctgcagaattacatctatgcagagtgttggaagttccatccggagatcgcacaaagaga
tgcaaagttcctggattcgcgtgagatcacaccacttttgaagtgagaggtctagattct
tctagtggagagcagaggaagctgtagtgctcttcccacagctgccaagtagatggctat
ctatggttgatccagtgtgaacaattgcctcttcttttgacaagaaagaaagtgcaccat
a

DBGET integrated database retrieval system