KEGG   Breviolum minutum: v1.2.033994.t1Help
Entry
v1.2.033994.t1    CDS       T04349                                 

Gene name
symbB.v1.2.033994.t1
Definition
(OIST) -
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smin03016]
    v1.2.033994.t1 (symbB.v1.2.033994.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     v1.2.033994.t1 (symbB.v1.2.033994.t1)
Transfer RNA biogenesis [BR:smin03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    v1.2.033994.t1 (symbB.v1.2.033994.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F PseudoU_synth_2 KH_1 FtsJ
Motif
AA seq 1220 aa AA seqDB search
MRCEVAMPSWKGRHNPALMEQKRIESGKLMSFAKAKRENKKIEARQEKRDLEDKYKALEE
NMKQRHAQELEAFESLDESLENETGAAEYLEIDPNEGTRKSRLQKKKDLLAEIEKELREG
RAEAEVAITLTGKRMMLRAPVAPQRTRIQSFEEILAAVRSGAMPSVMPVRAGSALARPSG
AFTLPARSLYDSGYRGQTFGPSGEDCPQARPEMLERAKEEARIAEEQGKLAVKKGPVPSG
PPGLPTGIVVIEQKYVDFLMGPGGQSLAAINHAAGVNVILDQTHKFSGYSYAKIFGPEDK
VRNAKLAIDFKLSQWLPLHERRKGITVAANPPAQPSGGSQESGLWSRSATASGGIAGATK
IHILRTQNPQPGTSPVKEIEDSAVKVTGGLLAVQIAMARHGTARGSAANRHGEVPVESNE
EFETFYQKQGVVAEELWQEFMHTLRSPMPLVVRINRTKPHWQELQRSFKQDMRWSELSWF
PSAWQCDAKDYNDALRSQCSALNKSYALRFQESASLVPPLLLEVKSSDLVLDLCAAPGSK
TLECIELMREHQLQDETGVIIANDADAERCFELLPLITRKARHPGCAVVLGNGAKYPAQF
RSQDDQLLYDKVICDVPCSGDGTLRRRPHCWKSWSMDFPLTLHSKQLLILCRGLHLLRPG
GRLVYSTCSMNPIENEAVVVAALKRFGADVHLLPVEIPKDLRVAPCLQSWWVPAGGTFYK
TWEEVPASQRKPAGPLVESMFSSGTLDPAACFRLNPHEIDGSGFFVAIFTKTSHRSFPIQ
IPARPSAAAIPWRARNESNRYTVVSIANSDVQSIVNFYGLRDLPEPLLAEYNIKGKLTQL
NLVNDTLLQVLQSHLNCKASPLLVSVGIPLFKLLDDNFMTNIDVPSRWRPAMEGASILAK
KMEKRVLRINLERMRKLLMKRLLPMQTLLSLGDELKGLESCEDKLGGAVVGTMDGSFWVP
CIITGSGLELYASLEEVGDPLPKLLPPKELPVISETKDVIVLDKPCGLRTEDALRFVQQR
HPSAELVSRLDKETSGCLLIPLTAESAKEFTKQFAETKVRKCYVAVVQGHPPETGHIEEA
LSLVQLGGGTKYRAFVDETGKAASTRYERIWSAGDQGPSVLLAYPETGRTHQIRCHLAHL
GHPLVGDTKYGGLVSLWCDRLPLHCLSLEAKGLSGDTLTTFAPIPEDLLLALLAMCDGEL
QREQWQQLCKSRAEAVSLGS
NT seq 3821 nt NT seq  +upstreamnt  +downstreamnt
ttattcttatccaagccatcgaatttgggcttcgggacatcagacaacgataccggtgag
tgactgcggagctgttggccatgcgcctgtgctatgagatgcgaagttgctatgccttcc
tggaaggggcgccataatccggccctgatggaacagaagaggatcgaatcagggaagttg
atgagtttcgcaaaggcgaagcgtgaaaacaagaaaattgaagcgagacaagagaaacgt
gatttggaggacaaatacaaggcgttggaagaaaatatgaagcagagacatgctcaagag
cttgaagccttcgaatccttagacgaaagtcttgagaatgaaacgggagctgctgaatat
ttggaaatcgatcccaatgaaggcactcgaaaatccaggctgcagaagaagaaggatctc
ttggccgaaattgaaaaggagctgagagaagggcgagcagaagccgaagtcgcgatcacc
ttgacaggaaagcggatgatgcttcgtgcaccagtggctccgcagcgaacacggatccaa
tcttttgaggaaatcttggctgcagtgcgctccggtgccatgccctcagtgatgccggtg
cgcgcgggctcggcattggcgcgacccagcggtgctttcactttgcctgcacgttccttg
tacgactcaggttacagaggccaaacctttggtccttcgggagaggattgtcctcaagcc
cgacctgagatgttggagcgagcaaaggaggaggcaaggatagctgaggaacaaggcaag
ttggcagtgaagaagggtcctgtaccaagcggccctccaggactaccaactggaatcgtg
gtcattgaacaaaaatatgtggactttctcatgggtcctggaggtcagtcgctggcagct
attaaccatgctgcgggtgtcaatgtaatcttggatcaaacccacaagttctctggttac
agctatgccaagatcttcggccctgaggacaaagtgagaaatgccaagttggccatcgac
ttcaagttgtcacaatggcttccactccatgaaaggcggaaaggcatcactgttgcagcc
aatccacccgcgcagccatcgggtggaagtcaagagtcaggtctgtggtcgcgctctgca
acagcttcgggaggcattgctggggctaccaaaatccatatcctgagaacccaaaatcct
cagccaggcacttccccggtgaaagagatcgaggattcagcagtgaaagtcactggtggg
ctcttggctgttcaaatcgccatggcccgacatggcacggcacgcggcagcgcggcaaac
cggcatggtgaagtgccagtggaaagcaatgaggaatttgagaccttctatcagaagcaa
ggggtggttgcagaggagttgtggcaggagttcatgcatactttgagaagcccgatgcct
ttggtagtgaggatcaaccgaaccaaaccgcactggcaggagcttcagcgctccttcaag
caagacatgcgttggtcagagctctcttggtttcccagtgcatggcagtgcgatgccaaa
gactacaatgatgccttgagatctcaatgttctgccttgaataaatcttatgcattgcgc
tttcaggaaagtgcgtcattggtgcctccactgctcctggaggtgaagtccagcgatttg
gtcttggacctttgtgcagcaccaggcagcaagaccttggaatgcattgagctcatgcgg
gagcaccagttgcaggatgagactggtgtcatcatagctaacgacgctgatgcggagcga
tgcttcgagttgctgcccttgatcactaggaaggctcggcatcccggttgcgcagtggtg
cttgggaatggcgccaagtatcctgcacagtttcgcagtcaggacgatcagttgctgtat
gacaaggtgatttgcgatgtgccttgctcgggggatggcaccctgcgacgacgtccacac
tgctggaagtcttggtctatggattttcccttgacattgcacagcaagcagctgctgatc
ttgtgccgtggccttcaccttttacgtcctggagggcgcttggtgtattcgacctgcagc
atgaacccaatcgaaaatgaggcagtggttgttgctgccttgaagcgcttcggagccgat
gttcacttgctgccggtggagattccgaaggatctacgtgtagcaccatgtcttcaatcc
tggtgggtgccagcaggcggtactttctacaagacctgggaggaagtgccagcatcccaa
cggaaaccagcagggcctttggtggaaagcatgttcagcagtggtaccttagatcctgct
gcatgctttcgattgaaccctcatgaaatcgatggctcgggtttcttcgtggcaatcttc
accaagacttcccatcgcagcttcccgattcaaatcccagctcgcccatctgcagcagca
attccatggagagccaggaatgaaagcaatcgctacacggtggtttctattgcaaattca
gatgtccagtccattgtgaacttttatggcctgagggatcttccagaaccattgttggca
gagtacaacatcaagggcaagttgacacaactgaatttggtgaacgatacgctgttgcag
gtcttacaaagtcatttgaattgtaaggcttcaccactcctggtttctgttggcattcct
ttattcaaacttttggatgacaacttcatgaccaacatcgatgtgccctcccggtggcgt
cctgccatggaaggggcctccatcttggccaagaagatggagaaacgggtgttgcggatc
aacctggaaagaatgaggaaattgctgatgaagcggcttctgcctatgcaaaccttgtta
tctttgggagatgagttgaaaggtttggaaagctgtgaagataaattgggaggcgctgtg
gttggaacaatggacggatctttctgggtgccttgcatcatcacaggcagtggcttagag
ctttatgccagcctggaagaggtaggagatccattgccaaagttgctacctccaaaagaa
cttccagtgatttctgagacgaaggatgtgatcgttttggacaaaccctgcggcctgcga
accgaggatgccttgcgttttgttcagcaaaggcatccctcggcagagcttgtctccaga
ttggataaggagactagcggttgccttctcattcccctaactgctgaaagtgcgaaggaa
tttacgaaacaatttgctgagacgaaggttcgaaagtgctatgttgcagtggtacaagga
catccaccagagacgggtcacatcgaagaagccttgagtttggtccaattgggtggtggc
accaagtacagagcctttgtggatgagactgggaaggccgcaagcactcgttatgaacga
atctggagtgcaggcgaccaaggtccgtcggtgcttttggcatatccggagactggcaga
acacaccaaatccgttgtcacctggcacatttgggacatccactcgtgggagataccaaa
tatgggggccttgtgtctttatggtgtgaccggttgccactacattgcttgtccttggag
gcaaagggcttgtcaggagatacattgacaactttcgcgccaatacctgaagatttgtta
ctagcacttcttgccatgtgcgatggcgagttgcaaagagagcagtggcagcagctttgc
aaaagcagagcagaagctgtgtctctaggatcatgagggtgtcatgtcgaaggttttgtc
agtgttcatccccgggaacatcacgacagatgcgaatggaa

DBGET integrated database retrieval system