KEGG   Breviolum minutum: v1.2.034398.t1Help
Entry
v1.2.034398.t1    CDS       T04349                                 

Gene name
symbB.v1.2.034398.t1
Definition
(OIST) -
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
smin  Breviolum minutum
Pathway
smin03040  Spliceosome
smin04141  Protein processing in endoplasmic reticulum
smin04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:smin00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smin01009]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:smin03041]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
   03009 Ribosome biogenesis [BR:smin03009]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
   03110 Chaperones and folding catalysts [BR:smin03110]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
   04131 Membrane trafficking [BR:smin04131]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
   03051 Proteasome [BR:smin03051]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
   03029 Mitochondrial biogenesis [BR:smin03029]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smin04147]
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Protein phosphatases and associated proteins [BR:smin01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     v1.2.034398.t1 (symbB.v1.2.034398.t1)
Spliceosome [BR:smin03041]
 Complex B
  Other components
   Prp19 complex
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
 Complex C
   Prp19-CDC5 complex
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Ribosome biogenesis [BR:smin03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Chaperones and folding catalysts [BR:smin03110]
 Heat shock proteins
  HSP70 / DNAK
   v1.2.034398.t1 (symbB.v1.2.034398.t1)
Membrane trafficking [BR:smin04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Proteasome [BR:smin03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Mitochondrial biogenesis [BR:smin03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    v1.2.034398.t1 (symbB.v1.2.034398.t1)
Exosome [BR:smin04147]
 Exosomal proteins
  Proteins found in most exosomes
   v1.2.034398.t1 (symbB.v1.2.034398.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
AA seq 715 aa AA seqDB search
MLGAGGEDTKASNGGVSQQGCKSDVELMQAFLHGLLAGKDQKVDIVFDLVSMDVVSSQVD
SKVSEAKCWPVRIDLTAVPVARAALHWPSVCPSEDCLPKSMGTNVVVLGDRGLEFSGSAD
PTAHTGVPHFAYRFAEERPWTGFQKPLWSSTLEVPPRLHRFVRFFMRVSFRFASGPLQRR
HWRSKQNGPHHSGRRAMRPSKRRRPVCIAVCAALLLVSLQNCFLNEAVRPGASEGRKVSE
VRRSTLLGLLVASGLPAAAVAEPRNQLPKCPTVYGEMVMCSLFPMIVGCLATPNCVGFMD
CTSPVVGEAATEQASNNLANTIFAPQRLLGASFDSPWAQRLRMSGPPDVVRGDDGSAMYR
VRDRGKVKILEPGEILAILLQQMKRQVEQCLGVHVKSAVVTVPAKYGRQQRKALEEACRM
AHLEVLALVKAPTAAAIAFSLTNPREGPREILVLDFGACYCDFCLLTLRGKSLYERAVGS
EFIDLDSLLVKFCLTDIKIRLGVDMSNDWAAVLRLSMACENAKRKLSQWNQTRVNVEALV
QGNDYCVAMSRSYFEEFCSRDIDSLLEIFDICLEESGLDRNLVDVVLVGGSSRIPRFRRL
VKDFFRGQPPSEVLRPDHAGVLGAAVYAAALGHLMANDSNDDFSVDAEGHLPANKQEAVS
TGGIYSFEGLQLEEIMPWSMLDPSNDNETTFDVPENEAFGFPKPSQAPRWKPSGT
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
gtatgtttgtggttcgcctcctttggacatggacagctttggtcctttccgctggagagg
caccacaggatgccaaacttttggagtacgaggtgaaggcgtgcaaacacacgctccttc
ccagttcgttggaaagccgtgcttttaccacatacacgggagaggttcatgtgcacgacg
tttttgggttaccttcgactgtcaaaaggcatgtcgtgagactcgatgtcgccaccgatg
ccttgctgactcttcagacggaggtgcacagagacacgcccacgaccttggccgtagata
tttttcgcagaggagattcagccaaaggaggcagccgcgttctactggggcgaaatatgc
tcggagctggtggagaagatacaaaggcctccaatggtggtgttagccaacagggctgca
aatctgatgtcgaactgatgcaggccttcctacatggtcttcttgcagggaaagaccaga
aggtggacatcgtctttgacctggtttccatggacgtggtttctagccaagtggattcaa
aagtgtcagaggcaaaatgttggcctgtgaggattgatctaacagcggtgcctgtggccc
gtgcagctttacactggccatctgtttgtccttctgaagattgtcttcctaagtcgatgg
ggaccaatgttgtcgtgcttggcgaccgtggtctcgagttttcaggctctgctgacccta
ctgcccacacaggtgtcccgcatttcgcctaccgttttgcagaggaacgaccatggaccg
gttttcagaagcctttgtggagtagcaccttggaggtgccacccaggctacatcgctttg
ttcgtttctttatgcgagtttcatttcgatttgccagtggacctctccagcgccgacatt
ggcgctcaaaacaaaacggcccgcatcattcaggtcgtagagctatgcggccttcgaaga
gacgacgaccagtgtgcatagctgtatgtgctgccttgcttctggtgagtctccagaact
gcttcctaaatgaagctgtgagaccaggagccagtgagggcaggaaagtctcagaggtgc
gccgtagcaccttgttgggtttgttggtggccagcggcttgccagcggctgcagtcgcag
agcctagaaatcagctgcccaagtgcccgacagtctatggagagatggtgatgtgctcat
tgttcccaatgatcgtaggttgtttggctactcccaattgcgtgggtttcatggactgta
cctcaccagtggtgggtgaagcggcaactgaacaagcgtccaataacttagccaatacaa
ttttcgcaccacagcggttattgggagctagtttcgacagcccctgggcacaacgtctac
gtatgagtggaccaccagatgttgttcgaggggatgatggctccgccatgtatcgcgtgc
gtgatcgagggaaagtgaaaatcttggaacctggggaaatcttggccattttgttgcagc
aaatgaaaaggcaagtggaacagtgtctgggagtacatgtcaagtctgcagtggtgacag
tgcctgccaagtatggtcgacaacagcgcaaggcattagaagaagcttgccgaatggcac
acttggaggttttagcacttgtcaaggccccaacagcagcagccattgctttttcattga
ccaatcctagggaaggtcctcgcgagattcttgtcctggatttcggtgcatgttactgtg
acttttgcttgctcactttgcgcggcaagagtctttacgagcgggccgtgggcagcgaat
ttattgatctggactctcttttagtgaaattctgtttgactgatatcaagattcgccttg
gcgtggacatgagcaatgattgggcggccgtcctgcgtttgtctatggcctgtgagaatg
ccaaaaggaaactttcacagtggaatcagacacgtgtgaacgtcgaagctttggtgcaag
gaaatgactactgtgtggcaatgtcccgcagttatttcgaagaattttgttctcgggata
tcgacagcttgttggagattttcgacatctgcctggaagaatccggactcgataggaact
tggtcgacgtggtgctggtcggtggatcatctcggattcctcgttttcgacgtttggtga
aggatttcttccgtgggcagcctcccagtgaggtgttacggcccgaccatgctggggtgc
tcggagcggcggtctatgcagcagccttgggacatttgatggccaatgatagcaatgatg
acttttcagtagatgctgaaggccacctacctgcaaataagcaggaggcagtgagcactg
gtggtatctacagctttgaaggtctacaactggaggagatcatgccatggtccatgctgg
atccgtcgaatgacaacgagacaacctttgatgtgccagaaaacgaagcctttggcttcc
caaagccatcccaggcgccccgatggaaacccagtgggacttgacatggtgcgagtccgt
gagttaagcaccctggttaagaaggcgcaggtttgtggtagaacgatgttgttggccacc
gcagcatgtcacaggctcaaccttttcacagcatcagctgggacggtgcgagccggtgat
gagcagagacggacaggctttaagccaagctccttatgaactaaatgtcatgaaagctcc
ggatgaagatccacccgaactgatcacagcctccctgagcagaccgtc

DBGET integrated database retrieval system