KEGG   Breviolum minutum: v1.2.040052.t1Help
Entry
v1.2.040052.t1    CDS       T04349                                 

Gene name
symbB.v1.2.040052.t1
Definition
(OIST) -
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smin04131]
    v1.2.040052.t1 (symbB.v1.2.040052.t1)
Membrane trafficking [BR:smin04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    v1.2.040052.t1 (symbB.v1.2.040052.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2
Motif
AA seq 602 aa AA seqDB search
MEPPTWQESLVLFDRAGGLPHIALQLPVPPKDTLPKEVYDDALRRLIHYPSALVAVLSYW
PLDIFSVSLLQELLRKELPSTTPGENPSQEERSRYEALALISEQNDPEMALDLLLALGSS
EAFKLLQRQAGREKLFMARLKKFFQVDHQQSCEVAVAFRGADVPVDDVCATLDGETRWKH
EYLKLLFAQDEIAGQGYHMQMVELFAEYDPMGLLPFLRASERYPLEEALAVCQRKGLREE
VAYLLGRAGRVSDALRILLEEVGDVGRAVEFASETQDPQLWNYLVTFVLQHTHLLVPLLD
HLDALESKRLRAVGSESQQPQPPPEATPAHVLRLLPAETPLPRIASSVQRVVDSLRLSAD
LHEACSKISASEMVSLKKACIAKCNRGTGTLAVSCNFCGGAVSSSGIVIVGRTVLHQQCH
QHEFLTFMRKYRDLEVQKVMQINERLRTSDAGENMVTLVDLPKLLMAIGYEDVAPEVLQE
CAALVHLVNRDMAIGMTSLNPSFTFDGIYHFLENLRSSHGFINEEYVDLRHAFLRFSNEQ
FSRSGFIEEDDGSSSAPEAEDEDARLSVLKLFHALRWLGYQMELWQVVEKMDSIRMVGSA
TL
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
cagttatcaaacattgccttagaaatgcctaacaaatgcatccattctctcagcttcagc
ttcaagtgcatggaaacttcgcctttatcatggcatcgtcgaaatgtttgaaactcgcct
tgccctttttggacgccttggagctcaccaggtcctcagccagctccaaggagctgagtt
tctgtgggaattccgttcagctctgggaggccctctgtcaacgttacctgggtgaagact
tgctgacacaacgtggggttaaagtgccatggccaaaacgagaagatgaaaatcccaagg
aatattttgaaaccttatatgaactgtatatgtttattacgcagaaagatgccatatctt
gtgatacatgcaaagaatgggccgcaatagaggatgatgccttggaatgtgaagaatgtc
ttgggaaatggtgtggcagttgtgcacatcgtggacctagcaaaagggatgttccttgta
aggaatgtccagatttttctcaatcccattgttgggaatgcttcgcagaagggaaaaata
tacagtgtgagtgctctggtactgacagttggcactcctgctgtggtcgccatgctttca
actgttcaaaatgcgatgcaacgttgtgcgatggctgccaagatcgtcatgattatgatt
gtccacggggtgagacggattctggcgaggaagatgggcaatgacgaggttcacgaggtt
caggtccccacgagttcaggtctcccacagatcagcattggatagatttagatactgtag
atcaattgttcgagctgccacttttttcggagttccaattgggaattctttgcagatgtc
aaccgcacttggcaatcctgaaatcagcaccgccagatgcgattcgaccgttttgcgttg
gaaaaacagatgacccagccgacgacaatgcagaactgccaagtgcagaattcctccatg
tttttttcgattgtgagagctgaggacatatggaaccgcccacttggcaggaatccttgg
ttttgtttgatcgtgcgggtggtttgccgcatatcgccttgcagctacccgtgcccccga
aagacacattgccaaaggaggtctatgatgatgcgctgcgtcggttgatccactatcctt
cagcccttgtggctgtcctttcttattggcctttggacattttctcagtcagtttgttgc
aggagctccttcgaaaagagttgccaagtacaacgcctggtgaaaatcccagccaggagg
aacgtagtcgctatgaggccttagccttaatctccgagcagaacgacccggagatggcct
tggatttgttgttggcccttggcagttccgaggcgttcaaactgcttcagcgtcaagctg
gccgagagaagctcttcatggcgaggttgaagaagttctttcaggtggatcatcagcaga
gctgcgaagtggctgtggcctttcgtggtgcggatgtgccagtggatgatgtttgtgcca
ctttagatggggagacacgatggaagcacgagtacttaaagttgttgtttgcacaggatg
aaattgctggacaaggataccatatgcagatggttgagctctttgctgagtacgacccaa
tgggtttgttgccctttttgcgagccagcgaacgatatcccttggaagaggctctggctg
tgtgccagcggaaaggtttgcgtgaggaagttgcttacttactcggccgtgccggccgag
tgtcagacgcattgaggattttattggaagaagtaggggacgttggacgagccgtggagt
ttgcgtctgagacgcaggatccgcagctctggaattacttggtgacctttgttttacaac
atacgcatcttttggtgccgcttctggatcacttggatgccttggagtccaaacgtttac
gtgccgtagggagtgagtcgcagcagccgcaacccccaccggaggcgactcctgcccacg
tactgcgacttttaccggcggagactcctttaccacgcatcgccagttcagtgcaaaggg
tggtggactcactgcgtctttctgcagatcttcatgaggcgtgctcgaaaatttcggctt
ccgagatggtaagcctcaagaaggcgtgcattgccaaatgcaatcgtggtaccggaactc
tggcagtgtcttgcaacttttgtggcggagcagtgtcatcttctggaattgtgatcgtgg
gccggacagtcctgcatcagcaatgccaccagcacgagttcttgaccttcatgcggaagt
atcgcgacctggaggtgcagaaagtcatgcagatcaacgaaagactcaggacaagtgatg
ctggggaaaacatggtgacattggtggatcttcccaagctgctgatggcgatcggctatg
aggatgtagcgccagaggtcttgcaggagtgtgctgcactagttcacttggtcaacaggg
atatggccataggcatgacatctttgaatccaagcttcacgtttgatggcatttatcact
tcttggaaaacttgcgatcttctcatggcttcatcaacgaagagtacgtcgacttgcgac
atgcgttccttcgcttcagcaacgaacagttctccagaagcggtttcattgaggaggatg
acggcagttcaagtgcacctgaggctgaagatgaggatgcacggttgtcagtgttgaagc
tcttccacgccttacgttggcttggctaccagatggagttgtggcaggtggtggaaaaga
tggatagcatccggatggttgggagtgctaccttat

DBGET integrated database retrieval system