KEGG   Sphingobacterium mizutaii: 4412673_01510Help
Entry
4412673_01510     CDS       T05395                                 

Definition
(GenBank) Probable aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
smiz  Sphingobacterium mizutaii
Pathway
smiz00130  Ubiquinone and other terpenoid-quinone biosynthesis
smiz00627  Aminobenzoate degradation
smiz01100  Metabolic pathways
smiz01110  Biosynthesis of secondary metabolites
smiz01120  Microbial metabolism in diverse environments
smiz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smiz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4412673_01510
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    4412673_01510
Enzymes [BR:smiz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     4412673_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: SNV48224
Position
1:1704425..1704997
Genome map
AA seq 190 aa AA seqDB search
MSRRKIVVAITGASGSIYAKVLLDKLQQLSEQIEAVGIVMSDNAKDVWKFELDNDSYKDY
DFPTYQKGDFMAPFASGSAKYDCMFVVPCSMGTMARIAHGVSSDLTTRAADVILKERRKL
ILLTRETPLSSIHIQNMALITQAGGIICPASPSFYSRPQSFEELAATVVDRALDIAGFDL
SGLNTFRWGK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagaaaaattgttgtagctattaccggggcctccggatctatttatgcgaaa
gtgctgttagacaagctgcagcagctttccgagcaaattgaagctgtcggaatcgtgatg
tcggacaatgccaaggacgtttggaagtttgaacttgacaacgatagttacaaagactat
gattttccgacctaccaaaagggagattttatggcgccatttgcatcgggttctgcaaag
tacgattgcatgtttgtagtaccttgttcgatgggaactatggctaggattgcacatggg
gtttcttccgacctgaccactagggcagccgacgtgatcctgaaggaaagaagaaagctg
attctcctcacccgtgaaacccctttgagtagcatccacatccagaatatggcattgatt
acgcaagcaggtggaattatctgtccggcttcgccttctttttacagccgtccgcaaagt
tttgaagagttggcagccaccgttgtcgatcgagccttagatatcgcaggttttgaccta
agcgggttaaatacctttcgctggggtaaataa

DBGET integrated database retrieval system