KEGG   Sphingobacterium mizutaii: 4412673_04080Help
Entry
4412673_04080     CDS       T05395                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
smiz  Sphingobacterium mizutaii
Brite
KEGG Orthology (KO) [BR:smiz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    4412673_04080 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: SNV66116
Position
1:4634388..4634774
Genome map
AA seq 128 aa AA seqDB search
MTTQTTSGVKISVESTYQSEYSNPENEHFMFAYRITIENLSEYTVQLVRRHWNIYDSIGL
NKQVDGDGVVGEQPILEPGQMHQYVSGCNLKSDMGFMEGYYEMIREMDNSIFHVHIPRFN
LIANYRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaaacaacttcaggcgttaaaatttcggttgagtcgacgtatcagtcagaa
tactctaatccagaaaacgagcacttcatgttcgcttaccggattaccattgagaatctg
agtgaatacaccgtccaattggtgcgtcgtcattggaatatttacgattctattggcctg
aacaagcaagttgatggtgatggcgtggttggtgaacaacctatcctcgagccgggccaa
atgcatcaatatgtatcaggttgcaatttaaaaagcgacatgggttttatggaaggttat
tacgagatgatccgtgagatggacaattctatcttccatgtgcatatcccgagattcaat
ctaatcgccaactaccgtctcaactag

DBGET integrated database retrieval system