KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_1496Help
Entry
SMULJ23_1496      CDS       T02086                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Pathway
smj00561  Glycerolipid metabolism
smj00640  Propanoate metabolism
smj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMULJ23_1496 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SMULJ23_1496 (gldA)
Enzymes [BR:smj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SMULJ23_1496 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAL69830
Position
complement(1576675..1577769)
Genome map
AA seq 364 aa AA seqDB search
MMKIFASPSRYIQGEKALFENAKAIINLGSHPILLTDNVVYDIVGKRFETYLNQEGLIVD
RIAFNGEASINEIDRVVAIAKEKGNDLIIGLGGGKTIDSAKAIADLLEIPVIIAPTVAST
DAPTSALSVIYTDQGAFEKYIFYSKNPDLVLVDTEVISKSPVILLASGIADGLATWVEAR
AVLQKNGQTMTGAGQTLASLAIAQACERTLFADGLQALAACEAKVVTRALENVIEANTLL
SGLGFESAGLAAAHAIHNGFTALTGDIHHLTHGQKVTYGTLTQLFLENRPKEEIDKYIHF
YRAIGMPTTLEEMHLGDADYSELLKIGQQATIEGETIHQMPFEIKAGDVANALLAVDQYT
RSLK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatttttgccagcccatcacgttatattcagggtgaaaaagctttatttgaa
aatgcaaaagctattattaatttgggttctcatcctatccttttaacagacaatgtcgtt
tatgatattgttggtaaacgtttcgaaacttatcttaaccaagaaggattgatagtagat
cgtatagcctttaatggtgaagcttcaataaacgaaattgatcgcgttgttgctatagct
aaagaaaagggaaatgatttaattattggtcttggtgggggaaagacgattgacagtgct
aaagccattgctgatttattagagatacctgttattattgctcctacagttgcctcgaca
gatgctccaacatcagccttgtccgtcatttatactgaccaaggtgcttttgaaaaatac
attttctattccaaaaatccagatcttgttttagtagatactgaagtcatcagtaaatct
ccagttattctactggcttcgggaattgcagatggacttgctacttgggtagaagcaaga
gctgtgcttcaaaaaaatgggcaaacaatgactggtgcagggcaaactttagctagcctt
gctattgcccaagcctgtgagcgtactttatttgcagatggtctacaagcgctggcagct
tgtgaagcaaaagtagtgacaagagcacttgaaaatgttatagaggctaataccttatta
agtggtttagggtttgaaagtgcaggtttggccgcagctcacgctattcataacggtttt
acagccttaacgggagatattcatcatctgacacatggtcaaaaagttacttatggaacc
ttaacgcaactctttcttgaaaatcgtccaaaagaagaaattgataagtatattcatttt
tatagagcaattggcatgccaacgactttagaagaaatgcacttgggagatgctgactat
tctgaacttctaaagattggccaacaagctacaattgaaggcgaaacgattcatcaaatg
ccatttgaaattaaggcaggtgatgttgccaatgcactcttagcagtggatcagtacact
agatcattaaaataa

DBGET integrated database retrieval system