KEGG   Sinorhizobium meliloti AK83: Sinme_0164Help
Entry
Sinme_0164        CDS       T01521                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
smk  Sinorhizobium meliloti AK83
Brite
KEGG Orthology (KO) [BR:smk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Sinme_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEG51935
Position
1:complement(183352..183744)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIIIANHSGLAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFDVAIPAFSL
DSPGLVRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcgctgacacgcgacatcgaagtgacggtcgagccgtactacctggaagaa
cagtcggatcccgacgacagccgctatgtctggggctatcgcatcatcatagcgaaccat
tccggactcgccgtccggctgatgacccgctactggcacattaccgacgagaacggtcag
gtggacgaggtgagcggccccggcgtgatcggcgagcagccgctgctcaatcccggcgat
acctacgagtactcctccggctgcccgctggatacaccctccggcgtgatgttcggccat
tacagcatggaggcggaaggcggggagactttcgatgtcgccatccccgccttctcgctc
gattcgccgggcctcgtccgcacgcttaattga

DBGET integrated database retrieval system