KEGG   Sinorhizobium meliloti AK83: Sinme_0177Help
Entry
Sinme_0177        CDS       T01521                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00071  Fatty acid degradation
smk00072  Synthesis and degradation of ketone bodies
smk00280  Valine, leucine and isoleucine degradation
smk00310  Lysine degradation
smk00362  Benzoate degradation
smk00380  Tryptophan metabolism
smk00620  Pyruvate metabolism
smk00630  Glyoxylate and dicarboxylate metabolism
smk00640  Propanoate metabolism
smk00650  Butanoate metabolism
smk00900  Terpenoid backbone biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
smk01212  Fatty acid metabolism
smk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sinme_0177
   00630 Glyoxylate and dicarboxylate metabolism
    Sinme_0177
   00640 Propanoate metabolism
    Sinme_0177
   00650 Butanoate metabolism
    Sinme_0177
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sinme_0177
   00072 Synthesis and degradation of ketone bodies
    Sinme_0177
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sinme_0177
   00310 Lysine degradation
    Sinme_0177
   00380 Tryptophan metabolism
    Sinme_0177
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sinme_0177
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sinme_0177
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sinme_0177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smk04147]
    Sinme_0177
Enzymes [BR:smk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sinme_0177
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sinme_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEG51948
Position
1:complement(195837..197045)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNGLDTSTVDDVIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WEKGYFKNSVVPVKDQNGLVILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLIGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYCQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggcgcgctgcacgaggtgccctccgtgcggctcgccgccaaggtgctcgaggccgtgcgg
gatcgcaacgggctcgacacttcgacggtcgacgacgtcatcatgggttgcgtcgacccg
gtcatggatgcgggtgcggtcatcccgaaagctgcagccttcgaggccggctattcgacg
cgtgcgcccggcatgcaaatctcccgcttctgcgcctccggcctcgacgcggtcaatttc
ggcgccgcgaagatcgcccaaggagcggacgacatcgtgatcgccggcggcgtcgagtcg
atgtcccgcgtcggcctgggcatgtcgggcggcgcctggttcatggacccctcggtcaac
ctgcccgcctatttcatgccccagggcgtttcggccgacctgatcgccacgaaatacggt
ttctcgcgcgacgacgtcgacgcctatgcggtggaaagccagaagcgcgccgccaatgcc
tgggagaagggctatttcaagaactcggtcgtcccggtcaaggaccagaacggcctggtc
attctcgaccgcgacgagcatatgcgccccggcaccgacatgcaggcactggcctcgctc
aacccttccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggcg
catccggagatcgagcgcatcaactatgtccaccacgccggcaattcctccggcatcgtc
gatggcgccgcggccgtgctcatcggctccaaggccggcggcgaagccatggggctcaaa
ccccgcgcccgcatccgcgccttcgccaatatcggctccgacccggccctgatgctgacc
gggccggtcgacgtcaccgagaagctcctgaagcgggccgacatgaagctctccgacatc
gacctgttcgagctcaatgaggccttcgcggccgtcgtgctgcgctactgccaggctttc
gacatcccgcacgataagatcaacgtcaatggcggcgcgatcgccatgggccatccgctc
ggcgcgaccggggcgatgatcctcggcaccgtgctcgacgagctggagcgccgcgacctc
aacacggcgctggtgacgctctgcatcggcgccggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system