KEGG   Sinorhizobium meliloti AK83: Sinme_1238Help
Entry
Sinme_1238        CDS       T01521                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00010  Glycolysis / Gluconeogenesis
smk00051  Fructose and mannose metabolism
smk00562  Inositol phosphate metabolism
smk00710  Carbon fixation in photosynthetic organisms
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
smk01230  Biosynthesis of amino acids
Module
smk_M00002  Glycolysis, core module involving three-carbon compounds
smk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_1238
   00051 Fructose and mannose metabolism
    Sinme_1238
   00562 Inositol phosphate metabolism
    Sinme_1238
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sinme_1238
Enzymes [BR:smk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sinme_1238
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sinme_1238
  Exosomal proteins of bladder cancer cells
   Sinme_1238
  Exosomal proteins of melanoma cells
   Sinme_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG52987
Position
1:1249769..1250539
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGDLSARVDALICPPATLLYVATALCDD
SPLMIGAQDCHQKQSGAHTGEVSAEMVADCFGTHVIVGHSERRTDHGEGDALVRAKTEAA
HGADLVAIVCVGETEEERKAGRTLHILKRQLAESLPDQATAENTVIAYEPVWAIGTGLTP
TVSDVEEAHAFMRRELVSRFGAEGGKMRILYGGSVKPSNAKELMGVANVDGALIGGASLK
ADDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctcgtcgccggcaactggaagatgaatggaacacgtgcg
tctctggaccagatcaaggcaatggcggagggcgtcaaaggcgacctttccgcgagggtt
gacgccttgatctgcccgccggccacattgctttacgttgcgaccgcgctttgcgacgac
agccctttgatgatcggggcgcaggactgccaccagaagcagtcgggagcccataccggc
gaagtctcggctgaaatggtcgccgattgtttcggcacgcatgtgatcgtcggccattcc
gaacggcgcaccgatcatggcgaaggcgacgcactggtgcgtgccaagacggaggccgcg
catggcgcggatctcgtcgcgatcgtttgcgtcggtgagacggaagaggagcgcaaggcc
ggccggacgctccatattctgaagcgccagctcgccgagagcctgccggatcaggcgacg
gccgaaaatacggtgatcgcctacgaacccgtgtgggcgatcggcaccggcctgacgccc
accgtgtccgacgtcgaggaggcgcacgccttcatgcgccgcgagctcgtctcgcgcttc
ggcgcggaaggcggcaagatgcggatcctctatggaggttccgtcaagccttcgaatgcg
aaagaactcatgggcgttgccaatgtcgacggcgccctgatcggcggcgcgagcttgaaa
gccgatgatttcctcgccatctacagggcctatgaagaattgactgcctga

DBGET integrated database retrieval system