KEGG   Sinorhizobium meliloti AK83: Sinme_1697Help
Entry
Sinme_1697        CDS       T01521                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00020  Citrate cycle (TCA cycle)
smk00480  Glutathione metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Module
smk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinme_1697
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sinme_1697
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sinme_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEG53432
Structure
PDB: 

Position
1:1702870..1704084
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDLDLEYYDLGVENRDATDDQVTIDA
ANAIKKHGVGVKCATITPDEGRVEEFKLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTKPIIVGRHAFGDQYRATDFKFPGKGKLSIKFVGEDGQTIEHDVYDAPGAGVALAM
YNLDESITEFARASFNYGLQRKVPVYLSTKNTILKAYDGRFKDIFQKVFDEEFAAQFKAE
KLWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAHRAKLDGNAELAKFSETLERV
CVDTVESGFMTKDLALLIGPDQPWLSTTGFLDKIDENLRKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcaaggtcgccaatccggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccttatctcgacctcgatctcgaa
tattacgacctgggcgtcgaaaaccgtgatgcaactgacgaccaggtgacgatcgacgcc
gcaaacgccatcaagaagcacggcgtcggcgtaaaatgcgccacgatcacgccggacgag
ggtcgcgtcgaggagttcaagctgaagaagatgtggaagtcgccgaacggcacgatccgc
aacatcctcggcggcgtcatcttccgcgagccgatcatctgcaagaacgtgccgcgcctg
gtccccggctggaccaagccgatcatcgtcggccgccacgccttcggcgaccagtaccgc
gcgaccgatttcaagttcccgggcaagggcaagctctcgatcaaattcgtcggcgaagac
ggccagacgatcgagcatgacgtttacgacgcgccgggcgccggcgtggcactcgccatg
tacaacctggacgaatcgatcaccgaattcgcgcgcgcctcgttcaactacggcctgcag
cgcaaggttccggtctatctctcgaccaagaacacgatcctgaaggcctatgacggccgc
ttcaaagacatcttccagaaggtgttcgacgaggaattcgccgcccagttcaaggccgag
aagctctggtacgaacaccgcctgatcgacgacatggtcgcctcggcgctgaagtggtcc
ggcggctatgtctgggcctgcaagaactacgacggcgacgtgcagtccgacatcgtcgcg
cagggcttcggctcgctcggcctgatgacctcggtgctgatgacgccggacggcaagacg
gtcgaggcggaagccgcccacggcacggtgacgcgccactaccgccagcatcagaagggc
gaggaaacctcgaccaactcgatcgcatcgatcttcgcctggacccgcggcctcgcccac
cgcgccaagctcgacggcaacgccgaactcgcgaagttctccgagaccctggagcgcgtc
tgcgtggatacggtcgagtccggcttcatgaccaaggatctggcacttctcatcggtccc
gaccagccctggctgtcgaccaccggtttcctcgacaagatcgacgagaacctcaggaag
gcaatggcggcgtaa

DBGET integrated database retrieval system