KEGG   Sinorhizobium meliloti AK83: Sinme_2158Help
Entry
Sinme_2158        CDS       T01521                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00471  D-Glutamine and D-glutamate metabolism
smk00550  Peptidoglycan biosynthesis
smk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sinme_2158
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinme_2158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smk01011]
    Sinme_2158
Enzymes [BR:smk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Sinme_2158
Peptidoglycan biosynthesis and degradation proteins [BR:smk01011]
 Precursor biosynthesis
  Amino acid ligase
   Sinme_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C IlvN 2-Hacid_dh_C NAD_binding_2 TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: AEG53878
Position
1:complement(2159480..2160871)
Genome map
AA seq 463 aa AA seqDB search
MIPVTSFKGRKVALFGLGGSGLATAQALVSGGADVVAWDDNPDSVAKAAAAGIATADLRG
ADWHAFAAFVLSPGVPLTHPKPHWSVDLAHQAGVEIIGDVELFVRERRKHAPDCPFIAIT
GTNGKSTTTALIAHILRTSGRDTQLGGNIGTAVLTLDPPKAGRFYVVECSSYQIDLAPTL
DPTAGILLNLTPDHLDRHGTMQHYADIKERLVAGSGTAVVGVDDSLSSLIADRVERAGTK
VVRISRRHPLAEGIYAEGSALMRAQDGASSLFTDLAGIQTLRGGHNAQNAAAAIAACLAV
GISGKDIVDGLRSFPGLKHRMQPVAKKGEVVFVNDSKATNAEAAAPALSSYDRIYWIAGG
LPKEGGITSLAPFFPKIVKAYLIGEAAPSFAATLGEAVPYEISGTLEKAVAHAAADAARD
SQGPAAVMLSPACASFDQYKNFEVRGDAFVGHVAALEGVSMLI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggtcacctcattcaagggcaggaaggtcgcactcttcgggctaggcggctcg
ggcctcgctacggctcaggcactcgtttcgggcggcgcagatgtcgtggcgtgggacgac
aatcctgacagcgtcgccaaggctgccgcggccggaatagccaccgctgatttgcgcggc
gccgactggcatgccttcgccgccttcgtgctttcgcccggcgttccgctgacgcatccg
aagccgcactggagcgtcgatctcgcgcatcaggccggcgtcgagatcatcggggatgtg
gagctcttcgtgcgtgagcggcgcaaacacgcgcccgattgccccttcatcgccatcacc
ggcaccaacggcaagtccacgacgacggcgctgatcgcccatatcctcaggacaagcggg
cgcgacacgcagctcggcggcaatatcggcaccgcggtgctgacgctggacccgccgaaa
gcagggcgcttctatgtcgtcgaatgctcatcctaccagatcgaccttgcgccaacgctc
gacccgaccgccgggatactgctcaacctgacgccggatcacctggatcgccacggcacg
atgcagcactatgcggacatcaaggagcgtctggtggcggggagcggaacggcggtggtc
ggcgtcgacgacagcctctcgagcctgatcgccgaccgggtggagcgggcaggaacaaag
gtcgtgcgtatctcgcgccgccaccctcttgccgaaggcatctatgccgaaggctcggcg
ctgatgcgtgcgcaggacggggcatcgtcgctctttaccgatctcgccgggatccagacg
ctgcgcggagggcacaatgcccagaatgctgcggctgcgatcgccgcctgcctggcggtc
ggcatctccgggaaggatatcgtcgacggcctcaggagctttccgggcctcaagcaccgg
atgcagccggttgcgaaaaagggagaggtcgtcttcgtcaacgacagcaaggcgaccaat
gcagaggctgcagccccggcgctttcgagttacgaccgaatctactggatcgccggcggt
ctgccgaaggagggcggcatcacgtcactggcgccgttcttcccgaagatcgtcaaggcc
tatctgatcggagaggcggccccctccttcgccgcgacactcggcgaggcagtgccctac
gaaatctccgggacgttggaaaaggcggttgcgcacgcggcagcggatgcggcgcgggac
tcgcaaggtccggcggccgtgatgctttctccggcttgcgcaagcttcgaccagtacaag
aacttcgaggtgcgcggagatgccttcgtcggccatgtggcggcgctcgagggcgtgagc
atgctgatctga

DBGET integrated database retrieval system