KEGG   Sinorhizobium meliloti AK83: Sinme_2370Help
Entry
Sinme_2370        CDS       T01521                                 

Definition
(GenBank) Aspartate transaminase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00220  Arginine biosynthesis
smk00250  Alanine, aspartate and glutamate metabolism
smk00270  Cysteine and methionine metabolism
smk00330  Arginine and proline metabolism
smk00350  Tyrosine metabolism
smk00360  Phenylalanine metabolism
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinme_2370
   00270 Cysteine and methionine metabolism
    Sinme_2370
   00220 Arginine biosynthesis
    Sinme_2370
   00330 Arginine and proline metabolism
    Sinme_2370
   00350 Tyrosine metabolism
    Sinme_2370
   00360 Phenylalanine metabolism
    Sinme_2370
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_2370
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_2370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smk01007]
    Sinme_2370
Enzymes [BR:smk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Sinme_2370
Amino acid related enzymes [BR:smk01007]
 Aminotransferase (transaminase)
  Class I
   Sinme_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEG54087
Structure
PDB: 

Position
1:complement(2373930..2375132)
Genome map
AA seq 400 aa AA seqDB search
MAFLADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRG
ETKYTPVSGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVI
PAPYWVSYPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAA
YSHEELKALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKA
YAMTGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQG
RRDLVVSMLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGV
AVVHGSAFGLGPNFRISYATSEALLEEACRRIQRFCAACR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccttccttgccgatgccctttcccgtgtaaagccttccgccaccatcgctgtttcg
cagaaagcccgcgagttgaaagcgaaaggccgcgatgtcatcggcctcggcgcaggggag
ccggacttcgacacgcctgacaacatcaagaaggccgcgatcgacgcgatcgatcgcggc
gagacgaagtacacgccggtctccggcattccggaactgcgcgaagccatcgcgaagaaa
ttcaagcgcgagaacaatctcgactacaccgcggcgcagacgatcgtcggcaccggcgga
aagcagattctcttcaacgccttcatggcgacgctcaacccgggcgacgaagtggtgatt
ccggcaccgtactgggtctcctatccggaaatggtggcgctgtgcggcggcacacccgtc
ttcgtcccgaccaggcaggaaaacaatttcaagctcaaggccgaggatctcgaccgcgcg
atcacgccgaagaccaagtggttcgtcttcaactcgccgtccaacccctcgggtgcggcc
tattcgcatgaggagctcaaggcgctcacggacgttctcatgaagcatccgcatgtctgg
gtcctgacggacgacatgtacgagcacctgacctatggcgacttcaggttcgcgaccccg
gtcgaagtggagcccggcctctacgagcgcacgctgacgatgaacggcgtctccaaggcc
tatgcgatgaccggctggcgcatcggctacgcggccgggccgcttcatctcatcaaggcg
atggacatgatccagggccagcagacttcgggcgccgcctcgatcgcgcagtgggcggcc
gtcgaggcgctcaacggtccgcaggacttcatcgggcgcaacaaggagatcttccagggc
cgccgcgatctcgtcgtctcgatgctgaaccaggccaagggcatttcctgcccgacgccg
gagggcgccttctacgtctatccgtcctgcgccggcctgatcggcaagaccgcgccttcg
ggcaaggtgatcgaaacggatgaggatttcgtctccgagcttttggagaccgaaggcgtg
gctgtggtccacggctcggccttcggcctcggcccgaacttccgcatctcctacgcgact
tccgaggcgctgctggaggaggcttgccgccgcatccagcgcttctgcgccgcctgcaga
taa

KEGG   Sinorhizobium meliloti AK83: Sinme_3283Help
Entry
Sinme_3283        CDS       T01521                                 

Definition
(GenBank) Aspartate transaminase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00220  Arginine biosynthesis
smk00250  Alanine, aspartate and glutamate metabolism
smk00270  Cysteine and methionine metabolism
smk00330  Arginine and proline metabolism
smk00350  Tyrosine metabolism
smk00360  Phenylalanine metabolism
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinme_3283
   00270 Cysteine and methionine metabolism
    Sinme_3283
   00220 Arginine biosynthesis
    Sinme_3283
   00330 Arginine and proline metabolism
    Sinme_3283
   00350 Tyrosine metabolism
    Sinme_3283
   00360 Phenylalanine metabolism
    Sinme_3283
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_3283
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_3283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smk01007]
    Sinme_3283
Enzymes [BR:smk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Sinme_3283
Amino acid related enzymes [BR:smk01007]
 Aminotransferase (transaminase)
  Class I
   Sinme_3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEG54990
Structure
PDB: 

Position
1:3358794..3360026
Genome map
AA seq 410 aa AA seqDB search
MTINATVKEAGFQPASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVK
QAASDAIHRGETKYTALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMA
SLDPGDEVIIPTPYWTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLL
NSPSNPSGAAYSAADYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNR
TLTVNGVSKAYAMTGWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDF
LKERTESFQRRRDLVVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDF
CAYLLEDAHVAVVPGSAFGLSPFFRISYATSEAELKEALERIAAACERLS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaatgcaacggtcaaggaggcgggctttcagcccgcctcgcggatttcctcg
atcggagtttcggaaatcctgaagatcggcgcccgcgccgccgccatgaagcgcgaaggc
aagccggtgatcatcctcggcgccggcgagccggatttcgacacgccggaacacgtgaag
caggccgcctcggatgcgattcaccgcggcgagacgaaatacaccgcactcgacggcacg
ccggaactgaagaaggcgatccgcgagaaattccagcgcgagaacgggttggcctacgag
ctggacgagatcacggtcgcgaccggcgccaagcagatcctcttcaacgccatgatggcc
tcgctcgatccgggcgacgaggtcatcattccgacgccctactggacctcctattcggac
attgtccatatctgcgagggcaagccggtcctgatcgcctgcgacgcatcttccggtttc
cgcctgacggcggaaaagcttgaggcggccatcacgccgcggacccgatgggtgctcttg
aactcgccctccaatccgtcgggcgccgcctacagtgcggccgactaccggccgctgctc
gaggtacttctgaggcacccgcatgtctggctgctcgtcgacgacatgtatgagcacatc
gtctatgacggtttccgcttcgtcaccccggcgcagttggagccgggcctgaagaaccgc
acgctgaccgtaaacggcgtctcgaaggcctatgcgatgaccggctggcggatcggctat
gccggtggcccgcgcgagctcatcaaggcgatggccgtcgtccagagccaggcgacctca
tgcccctcttcgataagccaggcggcttcggtcgcggcgctcaacgggccgcaggacttc
ctgaaagaacgaaccgagagcttccagcgccgccgcgatctcgtggtcaacggcctgaac
gcgatcgacggcctcgactgccgcgttcccgagggtgccttctacaccttctccggctgc
gccggcgtgctcggcaaggtgacgccatcaggcaagaggatcaaaacggatacggacttc
tgcgcctatcttctggaagacgcccatgtcgccgtcgtcccgggctcggccttcggcctc
tcaccctttttccgcatctcctatgcaacatcggaggcggagctgaaggaggcgctcgaa
cgaatcgctgcggcttgcgagcggctttcgtga

KEGG   Sinorhizobium meliloti AK83: Sinme_5759Help
Entry
Sinme_5759        CDS       T01521                                 

Definition
(GenBank) Aspartate transaminase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00220  Arginine biosynthesis
smk00250  Alanine, aspartate and glutamate metabolism
smk00270  Cysteine and methionine metabolism
smk00330  Arginine and proline metabolism
smk00350  Tyrosine metabolism
smk00360  Phenylalanine metabolism
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinme_5759
   00270 Cysteine and methionine metabolism
    Sinme_5759
   00220 Arginine biosynthesis
    Sinme_5759
   00330 Arginine and proline metabolism
    Sinme_5759
   00350 Tyrosine metabolism
    Sinme_5759
   00360 Phenylalanine metabolism
    Sinme_5759
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_5759
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_5759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smk01007]
    Sinme_5759
Enzymes [BR:smk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Sinme_5759
Amino acid related enzymes [BR:smk01007]
 Aminotransferase (transaminase)
  Class I
   Sinme_5759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEG57300
Position
3:466568..467806
Genome map
AA seq 412 aa AA seqDB search
MTLISKRLAAVRPSATKAMTARAAALREKGNDVVTLSQGEPDFETPDNVQLAGINAIRNG
KTRYTAVAGVKPLRQAIQHKLQLDNGLKYDIDEITVGCGAKQVVFNALFASLDPRDEVII
PTPCWVSYPDMVRLAGGEPVLVEAAERHGFKLRPAELEAAITPRTKWLMLNSPNNPTGAV
YSKAELAALAEVLRRHAHVHVLSDDIYEKLIYDMPFATMVSAAPDLCERVLTVNGVSKST
AMTGWRVGYGAGPKALIKAMNTIQGQTSSHTSSISQYAAIEAIGGPQDYLDTFVAELKKR
RDLVVDRVRQMPGLRCRVPEGAFYVFISCAGVLGKLTASGKVIESDMDFAMYLLEDFGVA
VVPGSGFMASPYIRISYASSVEELERACSRILAACVALSEGVQTHEQVKAIA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacactgatttctaaacgattggctgccgttcgcccctctgcaacgaaagccatgacc
gcccgggctgcggctctgcgcgagaaaggcaacgacgttgttacgctcagccagggcgag
ccggatttcgagacgccggataacgtgcagcttgccggcatcaacgcgatccgcaatggc
aagacgcggtacacggccgtggccggggtcaagccacttcgccaggccatccagcacaaa
ctgcagcttgacaacggtctcaaatacgacatcgacgagatcaccgtcggctgcggtgcc
aagcaggtggtcttcaacgccctctttgccagcctcgatccgcgggacgaggtgatcatc
ccgacgccttgttgggtttcctacccagacatggtacggcttgcaggtggtgagcccgtg
cttgtcgaagctgcggaacgccacggcttcaagctccggcctgcggaacttgaggcagcg
atcacgccgcgaaccaaatggttgatgctcaactcccccaacaatccaacgggggcagtt
tattccaaggcggagctcgccgctctcgccgaggttttacgccggcacgcccatgtgcat
gtgctctcggacgacatctatgaaaagctcatctacgacatgccgtttgccacaatggta
tcagctgcgcctgacctctgcgagcgagtacttacagtcaacggcgtgtcaaaatctacg
gccatgacgggctggcgcgtcggctatggtgccggcccgaaagctctgatcaaggcgatg
aacaccattcagggacagacgtcgtcgcacacgagctcgatttcccagtacgctgccatc
gaggccataggcggcccccaggactacctggacacctttgttgcggaactgaagaaacga
cgggatctggtcgtcgacagggtgagacaaatgcccggattacgctgccgcgtacccgaa
ggagcattctacgttttcatctcctgtgccggcgttcttggcaagttgacggcgagcggc
aaggtcatcgaatcggacatggatttcgccatgtatctcctcgaggactttggcgttgcc
gttgtgccgggcagcggcttcatggcctcgccctatattcgcatttcctatgcctcgtcg
gtcgaagagctggagcgcgcctgctcgcgcatcctcgccgcctgcgtcgcgctttccgaa
ggagtacagacccatgagcaagtcaaagcgattgcgtga

KEGG   Sinorhizobium meliloti AK83: Sinme_6917Help
Entry
Sinme_6917        CDS       T01521                                 

Definition
(GenBank) Aspartate transaminase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00220  Arginine biosynthesis
smk00250  Alanine, aspartate and glutamate metabolism
smk00270  Cysteine and methionine metabolism
smk00330  Arginine and proline metabolism
smk00350  Tyrosine metabolism
smk00360  Phenylalanine metabolism
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinme_6917
   00270 Cysteine and methionine metabolism
    Sinme_6917
   00220 Arginine biosynthesis
    Sinme_6917
   00330 Arginine and proline metabolism
    Sinme_6917
   00350 Tyrosine metabolism
    Sinme_6917
   00360 Phenylalanine metabolism
    Sinme_6917
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_6917
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_6917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smk01007]
    Sinme_6917
Enzymes [BR:smk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Sinme_6917
Amino acid related enzymes [BR:smk01007]
 Aminotransferase (transaminase)
  Class I
   Sinme_6917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEG58249
Position
pSINME02:complement(28891..30132)
Genome map
AA seq 413 aa AA seqDB search
MLAQRTALLKGSGTAAARAAAKEAADAGVQVVDLTAGEIWTDLAPTIRDGAIAAIDKGIN
RYTDTIGLMDLREALARKLTAQTGQAWGASEIAVTAGAKQALFNAAMVLLDPGDEVIIPA
PYWTTFPAQVQIAGGVPVHVDTRANGFVPRIEDIVAAITPRTRAIVINTPNNPTGTVYDR
TLLRALGELAIERDLWIIFDECYRDFIHTDVGHHSIVSVIPEARSRTVIVNAFSKALALT
GWRIGYLAGPDHLIRSVTALQSHTTSNPNVIAQHAVLHHLQNTDGRFEARLQNQLTAARN
MGLGVLSGLSRIPVPTAMGGFYFYLDIKNLVAPEPWNLVIGDRDVDMLVREMIAKAGVAT
VSGNAFGDPFGMRLSYGIPWDRLQEGLGRLVGFLNAWTYGATPEAENKEKESS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgcaacggacagccttgctcaaaggatcgggaacggctgcagcgcgcgccgcc
gcgaaagaggcggccgatgccggcgttcaagtggtcgatctgaccgcgggcgagatctgg
accgatctggcgccgacaatccgcgatggcgcgatcgccgcgatcgacaaggggatcaac
cgctacaccgacaccatcgggctgatggacttgcgcgaggcgcttgcccgcaagctgacc
gcgcaaaccggccaggcctggggagcaagcgagattgcggtgacggccggcgccaagcag
gcgttgttcaatgccgccatggtgttgctcgatccgggcgacgaagtcatcattcccgcg
ccctattggacgacctttccggcacaggtgcagatcgcgggcggcgtacctgttcatgtc
gataccagggccaacggcttcgtccctcgcatcgaagatattgttgccgcgatcacccca
cggacacgcgcgattgtcatcaacacgccgaacaatccgaccggcactgtctatgacagg
acgctcttgcgcgcgcttggcgagctcgccattgagcgcgatctctggatcatcttcgat
gagtgctaccgcgatttcattcacacggatgttggccatcattcgatcgtctcagttatt
ccggaagcacgctcccgcactgtgatcgtcaacgccttcagcaaggcactcgctctgacg
ggatggaggatcggctatctcgctgggccggaccatctcatcagatccgtcacggccctg
caatcccataccacgtccaatccgaacgtgatcgcccaacacgcggttttgcaccacttg
cagaacacagacgggagatttgaagcgaggttgcagaaccaactcacggccgcacgcaac
atgggtctcggtgtgctttcaggcctgtcgcgtatccctgtgccgacggcgatgggtggc
ttctatttctatctcgacatcaagaacctggtggcgcctgagccatggaaccttgtgatc
ggcgaccgcgacgtcgacatgctggttcgcgaaatgattgcgaaggcgggcgtcgcaact
gtttccggcaatgccttcggggatccctttggcatgcgcctttcctacgggatcccctgg
gatcgattgcaggaggggcttggccgccttgtcgggttcctcaatgcctggacctatggg
gccacgcccgaagccgaaaacaaagagaaagaatcgtcatga

DBGET integrated database retrieval system