KEGG   Sinorhizobium meliloti AK83: Sinme_2716Help
Entry
Sinme_2716        CDS       T01521                                 

Definition
(GenBank) Prephenate dehydrogenase
  KO
K00220  cyclohexadieny/prephenate dehydrogenase [EC:1.3.1.43 1.3.1.12]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01230  Biosynthesis of amino acids
Module
smk_M00040  Tyrosine biosynthesis, prephanate => pretyrosine => tyrosine
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_2716
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_2716
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     Sinme_2716
    1.3.1.43  arogenate dehydrogenase
     Sinme_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored IlvN 2-Hacid_dh_C Rossmann-like NAD_Gly3P_dh_N Semialdhyde_dh TrkA_N ApbA THF_DHG_CYH_C Sacchrp_dh_NADP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEG54423
Structure
PDB: 

Position
1:complement(2727903..2728829)
Genome map
AA seq 308 aa AA seqDB search
MMAQQFQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSA
AEAVEGADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHF
VPGHPIAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPK
HHDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDV
CLHNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIVQAGQDTAMPDF
GRHAMDQK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcagcagttccaaaccatcgcccttatcggcatcggcctgatcgggtcgtcc
atcgcccgggatattcgcgagaagcagctcgccggtacgatcgtggttacgacgcgcagc
gaagcgacgctgaagcgcgccggcgagttgggcctcggcgaccgctacacgctttcggcg
gccgaggctgtagagggcgcggatctcgtcgtcgtttcggtgccagtcggtgcatccggc
gctgtcgccgctgaaatcgcagcccatctgaaaccgggtgcgatcgtcaccgatgtcggt
tcgaccaaagggtcggtcatcgcccagatggcgccgcacctgcccaaggacgtccatttc
gtgcccggtcacccgatcgcgggtaccgagcattccggcccggatgccggctttgcgggc
ctcttccgcgggcgctggtgcattctgacgccgccggccggcacggacgaagaggcggtc
gccaggctcaggctgttctgggaaacgcttggctcgatggtcgacgagatggatccgaag
catcatgacaaggtgctggcgatcgtctcgcatctgccgcatatcatcgcctacaacatt
gtcggcaccgccgacgacctggagacggtgaccgagtccgaagtgatcaaatactcggcc
tcgggcttccgtgacttcacccgccttgccgcttcggacccgaccatgtggcgcgacgtc
tgcctgcacaacaaggacgcgatcctggaaatgctcgcccgcttctccgaggatctcgcc
tcactgcagcgcgcgatccgttggggcgacggcgacaagctcttcgatctcttcacccgc
acgcgggcgatacgccgctcgatcgttcaggccggtcaggacaccgcgatgcccgatttc
ggccggcacgcgatggaccagaagtag

DBGET integrated database retrieval system