KEGG   Sinorhizobium meliloti AK83: Sinme_2993Help
Entry
Sinme_2993        CDS       T01521                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00350  Tyrosine metabolism
smk00643  Styrene degradation
smk01100  Metabolic pathways
smk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Sinme_2993
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Sinme_2993
Enzymes [BR:smk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Sinme_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: AEG54700
Position
1:complement(3029717..3030370)
Genome map
AA seq 217 aa AA seqDB search
METGVANETVLYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAKAHRAPEHLARNPQGLV
PVLDIDGERLTQSLAIIEYLAETRDGTGLLPAHPIDRQRVRALSYAVAMDIHPVCNLGVV
ARVMAGAGDGEAARREWMQKFIGEGLAAFERMLDHPATGAFCHGDRPTMADLCLVPQVYN
ARRWDVDLAACPLLVAIDRRCAGIDAFQRAHPDRAKP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgggtgtggcgaacgaaaccgtgctttacgactattggcgctcgtcggcgagc
taccgggtgcggatcgccctcaacctgtgcggcgaagcctatcgctccgtcccggtcgac
ctgctcgcaaaggctcatcgcgcgccggagcatctcgcccggaatccgcagggattggtg
ccggtgctcgacatcgacggcgagcgcctcacccagtcgctcgccatcatcgaatatctt
gcggagacgcgggatgggacgggtctcctcccggcccatcccatcgaccggcaacgcgtc
cgcgcgctttcctatgccgtggcgatggatatccatcccgtctgcaatctcggcgtggtc
gcccgtgtgatggcgggcgcgggcgacggcgaggccgcgcggcgcgagtggatgcagaaa
ttcatcggcgagggtctcgctgccttcgagcgtatgctggaccaccccgcgaccggtgca
ttctgccatggcgatcgtccgacgatggcggatctctgccttgtgccccaggtctacaat
gcgcggcgctgggatgtcgatcttgcggcctgcccgcttctggtcgccatagatcgccgc
tgcgccggcatcgacgccttccagagggcgcatcccgaccgcgcaaaaccttag

DBGET integrated database retrieval system