KEGG   Sinorhizobium meliloti AK83: Sinme_3108Help
Entry
Sinme_3108        CDS       T01521                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00020  Citrate cycle (TCA cycle)
smk00640  Propanoate metabolism
smk00660  C5-Branched dibasic acid metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
Module
smk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinme_3108
   00640 Propanoate metabolism
    Sinme_3108
   00660 C5-Branched dibasic acid metabolism
    Sinme_3108
Enzymes [BR:smk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sinme_3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEG54815
Position
1:complement(3173353..3174549)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSYGAPVAEGVAIFSADEAEAAAKKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSVDEVVANAKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYL
SILVDRSVGQVAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPEKGVTAENLKTLADALKLE
GEARADAEKLFPILYKAFVEKDMSLLEVNPLIVMTNGRMRVLDAKVSFDGNALFRHEDVV
ALRDTTEEDDKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTQAFKIITADPAVKGILVNIFGGIMKCDVIAEGVLAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaataccaggccaaggctctgttgaagagctatggcgcgccggtcgcg
gaaggcgtcgcgatcttctccgccgacgaggccgaggcggccgcgaagaagctgccgggg
ccgctttacgtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaactcggccccgatgcgaagggcggcgtgcgcctggccaagtcggtggacgaggtcgtc
gccaatgccaaggacatgctcggcaacacgctggtgaccaagcagaccggtccggccggc
aagcaggtcaaccgcctctatatcgaggacggcgccgatatcgaccgcgagctctatctc
tcgatcctcgtcgatcgctccgtcggccaggtggccttcgtcgtttcgaccgagggcggc
atggatatcgaagcggtcgccgaacatacgccggagaagatcgtcaccgttgcgatcgat
ccggaaaagggtgtgaccgcagagaatctgaagacgctggccgacgcgctgaagctcgaa
ggcgaagcgcgtgccgacgccgagaagctcttcccgatcctctacaaggcattcgtcgaa
aaggacatgagcctgctcgaggtcaatccgctgatcgtcatgacgaacggccggatgcgc
gtcctcgacgccaaggtctccttcgacggcaatgcgctcttccgccatgaggacgtggtc
gcgctgcgcgacacgacggaagaggacgacaaggaaatcgaggcgtcgaaatacgacctc
gcctatgtcgccctggacggcaatatcggctgtatggtcaacggcgccggtcttgccatg
gcgacgatggacatcatcaagctctacggcgccgagcccgcgaacttcctcgatgtcggc
ggcggcgcctcgaaggaaaaggtcacccaggccttcaagatcatcacggccgatccggcg
gtgaagggcatcctcgtcaacatcttcggcggcatcatgaaatgcgatgtcatcgccgag
ggcgtgctcgcagcggtcaaggaagtcggcctcaaggtgccgctcgtcgtgcgcctggaa
ggcaccaatgtcgagctcggcaagaagatcatcaatgaatcgggcctcaacgtgatttcc
gccgatgatctggacgacgccgcccagaagatcgttgcagccgtgaagggagcctga

DBGET integrated database retrieval system