KEGG   Sinorhizobium meliloti AK83: Sinme_3226Help
Entry
Sinme_3226        CDS       T01521                                 

Definition
(GenBank) aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00020  Citrate cycle (TCA cycle)
smk00630  Glyoxylate and dicarboxylate metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
smk01210  2-Oxocarboxylic acid metabolism
smk01230  Biosynthesis of amino acids
Module
smk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
smk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinme_3226
   00630 Glyoxylate and dicarboxylate metabolism
    Sinme_3226
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Sinme_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEG54933
Position
1:complement(3285714..3288404)
Genome map
AA seq 896 aa AA seqDB search
MSKSLDSFNCRSTLTVNGVDYVYYSLPKAEANGLAGISKLPYSMKVLLENLLRNEDGRSV
TKKDIENIAAWLGDKGTAENEIAYRPARVLMQDFTGVPAVVDLAAMRDAMVSLGGDPEKI
NPLVPVDLVIDHSVIVDEFGTPTAFARNVELEYQRNGERYRFLKWGQQAFKNFRVVPPGT
GICHQVNLEYLGQAVWTREEDGEVTAYPDTCVGTDSHTTMINGLGVLGWGVGGIEAEAAM
LGQPVSMLLPEVIGFKLTGKLKEGVTATDLVLTVVQMLRKKGVVSKFVEFFGPGLDNMTL
ADRATIGNMGPEYGATCGFFPVDAETINYLTISGREEQRIALVEAYSKAQGMWREGDGSE
LVFTDTLELDLGDVVPSMAGPKRPEGRIALENIASGFAAALDNDYKKPGQLANRYAVEGT
DYDLGHGDVAIAAITSCTNTSNPSVLIAAGLLARNAVAKGLKTQPWVKTSLAPGSQVVAE
YLSKSGLQTDLDKLGFNLVGFGCTTCIGNSGPLPTEISKTINDKGLIAAGVLSGNRNFEG
RISPDVQANYLASPPLVVAYALAGSVQKDLTKEPIGEDRDGQPVYLRDIWPTSQEIQDFI
FRYVTRELYATKYADVFKGDANWQAVQVPAGQTYAWDEGSTYVQNPPYFVGMGKKGAGIS
DIKNARVLGLFGDKITTDHISPAGSIKAASPAGAYLLEHGVGIADFNQYGTRRGNHEVMM
RGTFANIRIRNHMLGPNGKEGGYTIHYPSKEEMSIYDAAMQYKEEGVPLVIFAGVEYGNG
SSRDWAAKGTNLLGVKAVIAQSFERIHRSNLVGMGVVPFVFEEGMTWESLGLKGDEVVTI
ENLANVQPREKRVAKITYGDGSVKEVPLICRIDTLDEVTYVNNGGILQTVLRDLAA
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaatccctagacagcttcaattgtcgctccacgctcacggtcaacggcgtggac
tatgtctattacagcctgccgaaggcggaggcgaacggcctcgccggcatttcgaagctt
ccctattcgatgaaggttctgctggaaaacctgttgcgcaatgaggatggacgctcggtc
accaagaaggacatcgaaaacatcgccgcatggctcggcgacaagggcacggccgagaac
gagatcgcctatcgcccggcgcgcgtgctgatgcaggacttcaccggcgttcccgccgtc
gtcgacctcgcggcgatgcgcgacgcgatggtttcgcttggcggcgacccggaaaagatc
aacccgctcgttcccgtcgatctcgtcatcgaccactcggtgatcgttgacgaattcggc
acgccgaccgcctttgcccgcaatgtcgagcttgagtaccagcgcaacggcgagcgctac
cgcttcctcaaatggggccagcaggccttcaagaacttccgcgtcgtgccgcccggcacc
ggcatctgtcaccaggtcaatctcgaatatctgggtcaggccgtctggaccagggaagag
gacggcgaagtcaccgcctatccggatacctgcgtcggcacggacagccacacgacgatg
atcaacggcctcggcgtgctcggttggggcgtcggcggcatcgaagccgaagcggcgatg
ctcggccagccggtttccatgctcctgccggaagtcatcggcttcaagctcaccggcaag
ctcaaggaaggcgtgaccgcgaccgacctggtgcttaccgtcgtgcagatgctgcgcaag
aagggcgtcgtctccaagttcgtcgaattcttcggccccggcctcgacaacatgacgctc
gccgaccgcgcgacgatcggcaatatgggcccggaatacggcgccacctgcggcttcttc
ccggtcgatgccgagacgatcaactatctcaccatctcgggccgtgaagaacagcgtatc
gcgctggtcgaagcctactccaaggcccagggcatgtggcgggaaggggatggttccgag
ctcgtcttcaccgacacgctggaactcgacctcggcgacgtcgtgccgtcgatggccggc
cccaagcggcccgagggccgcatcgcgctcgagaacatcgcctccggcttcgcggcggcg
ctcgacaacgactacaagaagcccggtcagctcgccaaccgctacgcggtcgagggcacc
gactacgatctcggtcatggcgacgtcgcgatcgccgcgatcacctcctgcaccaacacc
tcgaacccctcggtgctgatcgccgccggcctgcttgcccgcaacgccgtcgccaagggc
ctgaaaacgcagccctgggtcaagacgtcgctggcgcccggatcgcaggtcgtcgccgag
tacctgtcgaagtccggcctgcagacggatctcgacaagctcggcttcaatctggtcggc
ttcggctgcaccacctgcatcggcaattccggcccgctgccgacggagatctccaagacg
atcaacgacaagggcctgatcgccgccggcgtgctttccggcaaccgcaacttcgaaggc
cgcatctcgccggacgtccaggcgaactatctcgcctcgccgccgctcgtcgtcgcctat
gcgctggcgggttccgtccagaaggacctgacgaaggagccgatcggcgaagaccgggac
gggcaaccggtctacctgagggacatctggccgacttcgcaggagatccaggacttcatc
ttcagatacgtcacccgcgagctctacgcgaccaagtatgcggacgtgttcaagggcgac
gccaactggcaggcggtccaggttccggccggccagacctatgcctgggacgaggggtcc
acctacgtccagaacccgccctacttcgtcggcatgggcaagaagggcgccggcatttcc
gacatcaagaacgcccgcgtcctcggtctcttcggcgacaagatcacaaccgaccacatt
tccccggccggttcgatcaaggcggcctcgcctgccggcgcctatctcctcgagcatggc
gtcgggattgccgacttcaaccagtacggcacgcgccgcggcaatcatgaggtgatgatg
cgcggcaccttcgccaatatccgcatccgcaaccacatgctcggcccgaacggcaaggaa
ggcggttatacgatccactatccctccaaggaggagatgtcgatctatgacgcggccatg
cagtacaaggaggagggcgttccgctcgtcatcttcgccggcgtcgaatacggcaacggc
tcttcgcgtgactgggcggccaagggcacaaacctcctcggcgtcaaggccgtgatcgcc
cagtccttcgaacgcatccaccgttcgaacctggtcggcatgggcgtcgtccccttcgtc
ttcgaggaaggcatgacctgggaatcgctgggtctcaagggcgacgaagtcgtgacgatc
gagaatctcgccaacgtccagccgcgcgagaagcgcgtggcgaagatcacctatggcgac
ggctcggtgaaggaggtcccgctcatctgccgcatcgatacgctcgacgaggtcacctac
gtcaacaatggcggcatcctgcagacggttctgcgcgatctcgccgcctga

DBGET integrated database retrieval system