KEGG   Sinorhizobium meliloti AK83: Sinme_3492Help
Entry
Sinme_3492        CDS       T01521                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00010  Glycolysis / Gluconeogenesis
smk00260  Glycine, serine and threonine metabolism
smk00680  Methane metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
smk01230  Biosynthesis of amino acids
Module
smk_M00002  Glycolysis, core module involving three-carbon compounds
smk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_3492
  09102 Energy metabolism
   00680 Methane metabolism
    Sinme_3492
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinme_3492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smk04131]
    Sinme_3492
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smk04147]
    Sinme_3492
Enzymes [BR:smk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sinme_3492
Membrane trafficking [BR:smk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sinme_3492
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sinme_3492
  Exosomal proteins of melanoma cells
   Sinme_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEG55197
Position
1:3610437..3611072
Genome map
AA seq 211 aa AA seqDB search
MSGTLVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAKAGGKALADYGIKFDIAFTSVLI
RAQRTCQLVLDAVGQSSLETIRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDV
PPPGGESLRDTGARVWPYYLTDILPRVLSGEKVLVAAHGNSLRSLVMVLDKLTKEQILKL
NLATGVPMVYKLNADSTVASKEVLGDMSGAH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaccctcgtccttgtccggcacggccagagcgactggaacctgaagaacctc
ttcaccggctggcgcgatcccgacctcaccgaactcggcatcgaggaggcaaaggccggc
ggcaaggcgcttgccgattacggcatcaaattcgacatcgccttcacctccgtcctcatc
cgggcccagcgtacctgccagctcgtcctcgacgccgtcggccagtcgtcgctcgaaacg
atccgcgatcaggccctgaacgagcgcgactacggcgacctctccggtctcaacaaggac
gatgcgcgggcgaaatggggcgaagagcaggtccatatctggcgccgctcctacgacgtg
ccgccgcccggcggcgagagcctgcgcgacaccggcgcgcgcgtctggccctattacctg
accgacatcctgccgcgcgtgctttcgggcgagaaggtgctcgtcgccgcccatggcaac
tcgctgcgctccctcgtcatggtgctggacaagctgaccaaggagcagatcctcaagctc
aacctcgcgaccggagtgccgatggtctacaagctgaacgcggattcgaccgtcgcttcg
aaggaagtgctaggggatatgtccggggcgcattga

DBGET integrated database retrieval system