KEGG   Sinorhizobium meliloti AK83: Sinme_3636Help
Entry
Sinme_3636        CDS       T01521                                 

Definition
(GenBank) Tyrosine transaminase
  KO
K00832  aromatic-amino-acid transaminase [EC:2.6.1.57]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00270  Cysteine and methionine metabolism
smk00350  Tyrosine metabolism
smk00360  Phenylalanine metabolism
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk00401  Novobiocin biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01230  Biosynthesis of amino acids
Module
smk_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
smk_M00040  Tyrosine biosynthesis, prephanate => pretyrosine => tyrosine
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sinme_3636
   00350 Tyrosine metabolism
    Sinme_3636
   00360 Phenylalanine metabolism
    Sinme_3636
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_3636
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Sinme_3636
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smk01007]
    Sinme_3636
Enzymes [BR:smk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.57  aromatic-amino-acid transaminase
     Sinme_3636
Amino acid related enzymes [BR:smk01007]
 Aminotransferase (transaminase)
  Class I
   Sinme_3636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEG55340
Position
1:complement(3759640..3760809)
Genome map
AA seq 389 aa AA seqDB search
MFDALARQADDPLLALIGLFRKDERPGKVDLGVGVYRDETGRTPIFRAVKAAEKRLLETQ
DSKAYIGPEGDLVFLDRLWELVGGDTIERSHVAGVQTPGGSGALRLAADLIARMGGRGIW
LGLPSWPNHAPIFKAAGLDIATYDFFDIPSQSVIFDNLVSALEGAASGDAVLLHASCHNP
TGGVLSEAQWMEIAALVAERGLLPLVDLAYQGFGRGLDQDVAGLRHLLGVVPEALVAVSC
SKSFGLYRERAGAIFARTSSTASADRVRSNLAGLARTSYSMPPDHGAAVVRTILDDPELR
RDWTEELETMRLRMTGLRRSLAEGLRTRWQSLGAVADQEGMFSMLPLSEAEVMRLRTEHG
IYMPASGRINIAGLKTAEAAEIAGKFTSL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgccctcgcccgccaagccgacgatcccttgctggccctgatcggcctgttc
aggaaggatgagcgccccggaaaggtcgatctcggcgtaggagtctatcgcgacgagacc
ggacgcacgccgatcttccgggccgtcaaggcggcggaaaagcggcttctcgaaacacag
gacagcaaggcctatatcggccccgaaggggacctcgtctttctcgatcggctctgggaa
ctcgtcggcggcgacacgatcgagcggagccatgttgcgggcgtccagacgcccggcggc
tccggcgcgctccgtttggcggcggacctcatcgcccgcatgggcggccgaggcatctgg
ctcgggctgccgagctggccgaaccacgcgccgatcttcaaggcggccgggctcgatatc
gccacctacgacttcttcgacattccgtcgcagtcggtcatcttcgataatctggtgagc
gcgctggaaggcgccgcatccggcgatgcggtgctgctgcatgcaagctgccacaacccg
accggcggcgtcctgagcgaagcacaatggatggagatcgccgcgctggtggccgagcgc
ggcctgctgccgctcgtcgatctcgcctatcaggggttcggccgcggcctcgaccaggat
gtcgcgggcctccggcatcttctcggcgtggtcccggaagcgctcgtcgcagtttcctgc
tcgaagtccttcgggctttatcgcgagcgcgcgggcgcgatcttcgcgcggaccagctcg
actgcctcggcggacagggtgcgctcaaacctcgcgggcctcgcacgcaccagctattcc
atgccgccggatcacggcgcagccgtcgtgcggacgatccttgacgacccggaactcagg
cgcgactggacggaggagctcgagacgatgcggctcaggatgacgggcctccggcggtcg
cttgccgagggactccgcacccgctggcagagcctcggcgcagtcgccgatcaggagggc
atgttctccatgctgccgctttccgaagcggaggttatgcggctcaggaccgagcacggc
atctatatgccggcatccggccgcatcaacatcgccgggctgaagacggcggaagccgcc
gagattgccggcaagttcaccagtctctga

DBGET integrated database retrieval system