KEGG   Stenotrophomonas maltophilia K279a: Smlt0164Help
Entry
Smlt0164          CDS       T00718                                 

Gene name
fadI
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00071  Fatty acid degradation
sml00072  Synthesis and degradation of ketone bodies
sml00280  Valine, leucine and isoleucine degradation
sml00310  Lysine degradation
sml00362  Benzoate degradation
sml00380  Tryptophan metabolism
sml00620  Pyruvate metabolism
sml00630  Glyoxylate and dicarboxylate metabolism
sml00640  Propanoate metabolism
sml00650  Butanoate metabolism
sml00900  Terpenoid backbone biosynthesis
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
sml01212  Fatty acid metabolism
sml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smlt0164 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    Smlt0164 (fadI)
   00640 Propanoate metabolism
    Smlt0164 (fadI)
   00650 Butanoate metabolism
    Smlt0164 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Smlt0164 (fadI)
   00072 Synthesis and degradation of ketone bodies
    Smlt0164 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smlt0164 (fadI)
   00310 Lysine degradation
    Smlt0164 (fadI)
   00380 Tryptophan metabolism
    Smlt0164 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smlt0164 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smlt0164 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smlt0164 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sml04147]
    Smlt0164 (fadI)
Enzymes [BR:sml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Smlt0164 (fadI)
Exosome [BR:sml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smlt0164 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DDE_Tnp_IS66_C
Motif
Other DBs
NCBI-ProteinID: CAQ43773
UniProt: B2FHD0
Position
177952..179247
Genome map
AA seq 431 aa AA seqDB search
MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIG
GGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTSGFKFSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDT
SLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHV
SAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtatctccatgcccaacgctcgtcccgtcgccatcctcggtggcgtccgcatt
ccgttctgccgccagaacaccgcgtattcggatgtcggcaacctcggcatgtcggtccgt
acgctgggcgcgctggtcgaacggttcggcctgcacggccagcagctgggtgaagtggcg
atgggtgcggtgatcaagcactccagcgactggaacctgggccgtgaagccacgctgtcg
tccggcctgtcgccgctgaccccgggcatcacactgcagcgcgcctgtggcacctcgctg
gacagcatcatcaccgtcgccaacaagatcgcgctgggccagatcgaatcgggcatcggc
ggcggttcggacaccacctccgacgtgccgatcgtctacggcaagaagctgcgcgcgcgc
ctgctggccgccaaccgtgccaagagcactggcgacaagatccgcgcgctcacttccggc
ttcaagttctccgagctcaagcccgagttcccgggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgactcgcag
gacgagtgggcggtgtcctcgcacaagaagctggccgctgcctatgagcgcggtttcttc
aacgatctgatcgcaccgttccgtggcgtcgagcgcgacaacatcctgcgtccggatacc
tcgctggaaaagctggccacgctgaagccggccttcgacaaggtctccggccgtggcacc
ctgaccgccgccaactccacgccgttgaccgatggcgccgccgcggtgctgctggccagt
gaagagtgggcgcgtgcgcacggccatgagccgcaggcgtacctgcgcgatgcgcacgtc
tctgcggtggacttcgtgcatggcgaaggcctgctgatggcaccgaccgtggccgtgccg
gagatgctcaagcgcaatggcctgaccctgcaggacttcgacatctacgagatccacgag
gccttcgctgcacaggtgctgtgcaccctgcgtgcgtgggagagcgaggattactgccgc
aaccgcctgggcctggatgcaccgatgggccgtatcgacccggacaagatcaacctgctg
ggctcgtcgctggccaccggccatccgttcgccgccaccggtgcacgtgtgattgctacc
gcagccaagcagctggccgaacgcggcggtggccgcgcgctggtgtcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtcgaacgctga

DBGET integrated database retrieval system