KEGG   Stenotrophomonas maltophilia K279a: Smlt0196Help
Entry
Smlt0196          CDS       T00718                                 

Definition
(GenBank) putative two-component sensor/response regulator protein
  KO
K07679  two-component system, NarL family, sensor histidine kinase EvgS [EC:2.7.13.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smlt0196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sml01001]
    Smlt0196
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sml02022]
    Smlt0196
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Smlt0196
Protein kinases [BR:sml01001]
 Histidine kinases
  NarL family
   Smlt0196
Two-component system [BR:sml02022]
 NarL family
  EvgS-EvgA (acid and drug tolerance)
   Smlt0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 HATPase_c Response_reg HisKA PAS_3 Hpt Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: CAQ43805
UniProt: B2FHG2
Position
206193..209858
Genome map
AA seq 1221 aa AA seqDB search
MATGQAGPRPSRPCQDSRRSTPMRSWAVRGLVLLLAVLVLPVALAQAVPGLLPLSPLQRE
YLAAHPSIVVGQYDSGWPPFESLRDGQQVGLGPDYLALLARQLGVKVEARRYSDWTSVLD
AACRGEIDVVMNVGLSADRTQCMVYTAAYGEAPLALVGRPGDLRASNMPDLDGLRVVIEQ
DFLTGPQVRARFPRAVQLVANSSLAALQMVRDDKADVYIGNAYVATELIARLRLQGVVLL
RPSDLPPERMHFGVPNSKQPLAEALDLALAATSQAQRDALAQRWLPLPQWSASAQLALSQ
AEKRVLQQPLKIGFAPNAAPLSFADEDGRPSGLASEYLARLMQAGANLQAQNSHDWYEVR
EKARRGELQAVMGIPVDSHYLGPDWVYSQPFISVPNVIVSRHDSPALLGLSDLQDKRVLL
SDPERVRGYVLQQAPQARIVAARSAEQAMQRLIDGEADAYVGNLALVDHLLRTRFPGRLQ
VAAPAGFNDQLALAVERRHAALATTFDRLLLQMTPREREALRGDWLAVEYHNGIDWRSTL
RWGVPLLLVLLTALLVHGIGYWRLRREVAGRRQLEQRLAEVTDNLPAVVYQARREVDGTL
SFPFIAGDLQALFGITRQQAEQDATMLLERVEEDDRARILQVVEQAAHQFAPLMLEFRLR
GDGAGPRWVRTQAQPYAAEAGVVTWSGYWVDASEARAQADALTAAKAEAEQAAEAKSRFL
ATMSHEIRTPMSGVLGMLEVLAHSPLDAEQKRILGVIEDSAQMLRQILDDILDYSRLEAN
ALRLEPVPQPLRPLLESVCRLLSAQASARGLGLHVQIDPQLAAAHEVDGVRLRQIVFNLL
SNAIKFTVRGEVRLQLEVLGPTAEDGSQPLCLSVTDTGIGIAPEQLQHLFAPFTQAGAYI
QRDHGGTGLGLSICQRLVQMMDGELELHSTLGEGTRAEVRLSLVEAGSSDVEALVAEQEQ
AALLPPALRQARVLVIEDHPTNQAMMAWRLQQLGVPHVLVGDGQQGLDRLASEHFDLVIT
DCRMPVLDGFAFTRLLREREGRNGQPRLTVLALTASVLDDDARRCREAGMDEVLAKPLSL
ATLRAALLRWLPQAQGQRFEEPLAESAAVDDRTLPDLDSLQRRFGSRAVAEQLRDSLLQA
SAGDLAAVQRALEAGDREAAALHLHRQAGGLGAVGATVLAAQANALVERLQDAAETDPVP
LFTAVAAFVARLQQRLQRLAH
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgggcaagccgggccgcgaccatcgcggccctgtcaggattctaggagatcg
acgccgatgcgtagctgggctgttcgcgggctggtcctgctgctggccgtgctggtgctg
cccgtggcgctggcacaggctgtgcctgggctgttgccgctcagtcccctgcagcgcgag
tacctcgccgcccatccaagcatcgtcgtgggccagtatgacagcggctggccgccgttc
gagtccctccgtgatggccagcaggttggcctgggtccggattatctggcgcttctcgcc
cgtcagctgggtgtgaaggtcgaggcgaggcgttattccgactggacatccgtgctggat
gcggcctgtcgtggcgagatcgacgtggtaatgaatgtcggtctcagtgccgaccgcacc
cagtgcatggtctataccgctgcctatggcgaggcgccgttggcgctggtggggaggccg
ggcgatctgcgtgcttcgaacatgcccgacctggacggattgcgggtggtcatcgagcag
gatttcctgaccggaccgcaggtgcgggcacgtttcccgcgtgcggtgcagcttgtcgca
aacagctcgttggctgcgctgcagatggtcagagacgacaaagctgatgtctacataggc
aatgcctacgttgccaccgaactgatcgcacgcctgcgcctgcagggtgtcgtcctgctg
cgtccgagcgacctgcctcccgaacggatgcacttcggcgttcccaacagcaagcaaccg
ctggccgaagcgctggacctggcgctggccgcgaccagccaggcccagcgcgatgcactg
gcacaacgctggctgcccctgccgcagtggtcggcatcggcgcagctggcgctcagccag
gccgagaagcgggttctgcaacagccgttgaagatcggcttcgcgccaaacgccgcccca
ttgtcgttcgccgacgaggatggcaggcccagcggcctggccagcgagtacctggcgcgg
ctgatgcaggccggtgccaacctgcaggcgcagaacagccatgactggtacgaggtgcgc
gagaaggcgcgccgcggcgagttgcaggcggtgatgggcattccggtcgattcgcactat
ctgggcccggactgggtgtacagccaacccttcatcagcgtgccgaacgtgatcgtcagc
cgccacgacagcccggcgctgctgggcctgtccgacctccaggacaagcgcgtactgctg
tcggatccggagcgcgtacgcggttacgtgctgcagcaggcgccgcaggccaggatcgtc
gccgcgcgcagcgccgaacaggccatgcaacgcctgatcgatggtgaggccgacgcctac
gtgggcaatctggccctggtcgaccacctgctgcgcacgcgtttcccggggcgcctgcag
gttgccgcgcccgcgggcttcaacgaccagctggcactggccgtggagcgccggcatgcg
gcgctcgccacgaccttcgatcgcttgctgctgcagatgacgccacgcgagcgcgaagcg
ctgcgcggcgactggctggcggtggagtaccacaacggcatcgactggcgaagcacgctg
cgctggggtgtaccgctgctgctggtgctgctgaccgcgctgctggtgcatggcatcggc
tactggcgcctgcgtcgcgaggtggccgggcgccgccagctggagcagcgcctggccgaa
gtgaccgacaacctgcctgccgtggtctaccaggcccgtcgcgaggttgatggcacgctc
agcttcccgttcattgccggtgacctccaggcgctgttcgggatcacccgacagcaggct
gagcaggacgccacgatgttgctggaacgcgtcgaagaggacgatcgcgcgcgcatcctg
caggtggtcgaacaggccgcgcaccagttcgcaccgctcatgctggaattccgcctgcgg
ggcgatggagcgggcccgcgttgggtgcgcacccaggcgcaaccctatgccgccgaagcc
ggtgtggtgacctggagtggctactgggtggatgccagcgaggctcgtgcacaagcggac
gccctgaccgcagccaaggccgaggccgagcaggcggccgaggcgaaatcccgcttcctg
gccaccatgagccatgagatccgcacgccgatgagtggcgtgctggggatgctggaagtg
ctggcgcactcaccgctggatgcagaacagaaacgcatccttggcgtgatcgaggattcg
gcgcagatgctccggcagatccttgacgacatccttgactactcgcggctggaggccaac
gcattgcggctggagccggtaccgcagccgctgcggccgttgctggaaagcgtgtgccgg
ttgttgtcggcgcaggccagtgcacgtgggctgggcctgcacgtgcagatcgatccgcag
ctggcagccgcgcacgaagtggatggcgtgcgtctgcgccagatcgtgttcaacctgctc
agcaacgccatcaagttcaccgtgcgcggcgaagtgcggctgcagctggaagtgctgggg
ccaaccgccgaagacggcagccagccgctgtgcctgagcgtcaccgataccggcatcggc
atcgcaccggaacagctgcagcacctgtttgcgccgttcacccaggccggtgcgtacatc
cagcgcgaccatggtggaaccggcctgggcctgagcatctgccagcgcctggtgcagatg
atggacggcgagctggaactgcacagcacgctgggcgagggcacccgcgccgaggtgcgg
ctgtcgctggtggaagccggcagcagtgatgttgaagcgctggtcgccgagcaggaacag
gcggcgctgctgccgccggcgctgcgccaggcacgcgtgctggtgatcgaagatcatccg
accaaccaggcgatgatggcctggcggctgcagcaactgggtgtaccgcatgtgctggtc
ggcgatggccagcaggggctggatcgcctggcatcggagcactttgatctggtcattacc
gattgccggatgccggtactggatggtttcgccttcacccgcctgctgcgcgaacgcgaa
ggccgcaacggccagccgcggctgaccgtactggcgctgaccgccagcgtgctggacgac
gatgcacgtcgttgccgtgaagccgggatggatgaggtgctggccaagccattgtcattg
gcgacactgcgcgcggcactgctgcgctggttgccgcaggcgcaggggcaacggttcgag
gagccgctggccgagtccgctgccgtcgatgacaggacgctgcccgatctggacagcctg
cagcggcgcttcggctcacgcgcggtcgccgagcagttgcgcgacagcctgctgcaggcc
agtgcaggtgacctggccgctgtgcagcgcgcgctggaggccggcgaccgtgaggctgcc
gcgctgcacctgcatcgccaggccggtggcttgggcgcggtgggagcgacggtgctggct
gcgcaggccaatgccctggtcgagcgcctgcaggatgcggccgagaccgatccggtgccg
ttgttcaccgcggtggcggcattcgtggcgcggctgcaacagcggttgcagcgcctggct
cactga

DBGET integrated database retrieval system