KEGG   Stenotrophomonas maltophilia K279a: Smlt0471Help
Entry
Smlt0471          CDS       T00718                                 

Definition
(GenBank) putative acetyl-CoA hydrolase/transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00020  Citrate cycle (TCA cycle)
sml00620  Pyruvate metabolism
sml00650  Butanoate metabolism
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
Module
sml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smlt0471
   00620 Pyruvate metabolism
    Smlt0471
   00650 Butanoate metabolism
    Smlt0471
Enzymes [BR:sml01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Smlt0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: CAQ44067
UniProt: B2FKU8
Position
complement(483463..484977)
Genome map
AA seq 504 aa AA seqDB search
MSVDRIANARLRDRVVSAEAAAALIQPGETVAMSGFTGSGYPKAVPVELARRIEAVHAQG
NPFQIKLMTGASTAPELDGALAKADGIAMRMPFQSDPDARNRINEGKLDYIDIHLSHVAQ
HVWFGFYGEIDTAVIEVSAIREDGSLVPSTSVGNNKTWLDLAKKVIVEVNEWQPAGVDGM
HDIYYGTALPPHRKPIPLVNANDRIGDTALRCDPDKIVAVVRTNGPDRNSPFSPIDATSE
QIASHLIEFLKHEVKKGRLPPNLLPLQSGVGNIPNAVLAGLAKSGFRDLAAFTEVIQDGM
LDLLRDGVLSYASCTGFALSPQANETFKENIDFYRERIIMRTQEISNHPELVRRLGCIGM
NGMIEVDIYGNVNSTHVMGTRIMNGIGGSGDFARNGFLSAFLSPSTAKNGTISAIVPMAS
HVDHTEHDVSVIVTEQGLADLRGLTPRKRAQVLIDNCAHPDFRPQLQDYFDRASRESYGK
HTPHLLPEALSWHQRWLDTGTMKG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgatcgcatcgccaacgcgcgtctccgtgaccgcgtggtctccgcagaggcc
gcagccgcgctgatccagcccggtgaaaccgtggccatgagcggctttaccggctccggg
tatcccaaggccgttcccgtcgaactggcccgccgcatcgaagcggtgcatgcccagggc
aaccctttccagatcaagctgatgaccggcgcctccaccgcgccggaactcgatggcgcg
ctggccaaagccgatggcatcgcgatgcgcatgccgttccagagcgacccggatgcgcgc
aaccgcatcaacgagggcaagctggactacatcgacatccacctcagccacgttgcccag
cacgtgtggttcggcttctacggcgagatcgataccgccgtgatcgaagtctcggccatc
cgcgaggatggctcgctggtgccctccacctcggtcggcaacaacaagacctggctggac
ctggcgaagaaggtgatcgtcgaggtcaacgaatggcagccggccggcgtcgacggcatg
catgacatctactacggcaccgcgctgccgccgcaccgcaaaccgattccgctggtgaac
gccaacgaccgcatcggcgacaccgcgctgcgctgcgacccggacaagatcgtggccgtg
gtacgcaccaacggcccggaccgcaacagcccgttcagcccgatcgatgcgaccagcgag
cagatcgcttcgcacctgatcgagttcctcaagcacgaagtgaagaagggccgcctgccg
ccgaacctgctgccgctgcagtcgggcgtgggcaacattcccaacgcggtgctggccggc
ctggccaagagcggtttccgcgacctggccgcgttcaccgaagtgatccaggacggcatg
ctcgacctgctgcgcgacggcgtgctgagctatgcctcgtgcacgggtttcgcgctgagc
ccgcaggccaacgagacgttcaaggagaacatcgatttctaccgcgagcgcatcatcatg
cgcacgcaggaaatctccaaccatccggaactggtgcgccgcctgggctgcatcggcatg
aacggcatgatcgaggtggacatctacggcaacgtcaattcgacgcacgtgatgggcacg
cggatcatgaacggcatcggcggttccggcgacttcgcccgcaacggtttcctgtcggcg
ttcctgagcccgtccaccgcgaagaacggcaccatttcggcgatcgtgccgatggccagc
catgtcgaccacaccgagcacgacgtgtcggtgatcgtcaccgaacagggcctggccgac
ctgcgtggcctgaccccgcgcaagcgcgcgcaggtgctgatcgacaactgcgcgcatccg
gatttccgtccgcagctgcaggattacttcgaccgcgccagccgcgagagctacggcaag
cacaccccgcacctgctgccggaagcgctgtcgtggcaccagcgttggctggataccgga
acgatgaagggctga

DBGET integrated database retrieval system