KEGG   Stenotrophomonas maltophilia K279a: Smlt0586Help
Entry
Smlt0586          CDS       T00718                                 

Definition
(GenBank) putative phosphoglycerate mutase family
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00860  Porphyrin and chlorophyll metabolism
sml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Smlt0586
Enzymes [BR:sml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Smlt0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 QSregVF_b
Motif
Other DBs
NCBI-ProteinID: CAQ44173
UniProt: B2FLR9
Position
596705..597283
Genome map
AA seq 192 aa AA seqDB search
MILDLVRHAGNGRDEFLDGRSDPPQLAGLPQELVEAYAGQRWERVISSPRLRALHTAMAL
ATPRGLDVEADEEWEELDFGDWDGRSLFDLPEDALAAFHADPHAFPPPNGESWGHFERRI
ARALDRLLDDDDPVPTLVVSHGGPLRMVLSQVCGLPMSLCWALRIDHGTRLRVWLERGEI
GLVGELLELQQP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacctggtccgccatgccggcaacggtcgcgatgagttcctcgatggccgc
agcgacccaccgcagctggccggcctgccacaggagcttgtcgaggcctatgccgggcaa
cgctgggagcgggtgatcagttcaccgcggttgcgcgcgctgcatacggcgatggccctg
gccacgccgcgtgggctggacgtggaagcggacgaggaatgggaagagctggacttcggc
gattgggacgggcggtcgctgttcgacttgccggaggatgcactggcggccttccatgcc
gacccgcacgcgttcccgccgcccaatggcgagagctggggccacttcgagcgacgcatc
gcgcgcgcgctggatcgcctgctcgatgatgacgatccggtgccgacgctggtggtcagc
catggcggcccgttgcgcatggtgctgtcgcaggtctgcggcctgccgatgtcgctgtgc
tgggcgctgcgtatcgaccacggcacgcgcctgcgggtgtggctggagcgcggcgagatc
gggctggtgggtgagctgctggagctgcagcagccctga

DBGET integrated database retrieval system