KEGG   Stenotrophomonas maltophilia K279a: Smlt1284
Entry
Smlt1284          CDS       T00718                                 
Symbol
trbG
Name
(GenBank) putative conjugal transfer protein
  KO
K20532  type IV secretion system protein TrbG
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1284 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1284 (trbG)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1284 (trbG)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: CAQ44833
UniProt: B2FTD6
Position
complement(1325996..1326982)
AA seq 328 aa
MNDLFRKSVLPIMLLALAGCATQGKPPPAISLDEPVQAQTLPDVPKPVEVVGVPEPLALP
GQMKPLPGGDAKSAPEPADEKTRVTRANTEARIAPTREGYVNAIQVWPFTDGALYQVYAA
VGRVTVVALQPGEELVTVAAGDTVRWIVGDTSSGSGADLRVSVMVKPIRSGLKTNLVITT
SRRTYLLELTSTEKTWMASVSWEYPKDRMLALQRQAQAASAAAPVDAGLSLEKIRFRYAI
SGSNPPWKPERVFDDGQKVYVQFPSGIAQGELPPLFVIGAQGDGQLVNYRFRSPYLIVDR
LFGAAELRLGGAKGDVVRIERTDGAKGK
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaatgatcttttccgtaaatccgtcttgccgatcatgttgcttgccctcgcgggctgc
gccacgcagggcaagccgccgccagccatctcgctcgacgagccggtgcaggctcagacg
ctgcccgatgtgccgaaaccggttgaggtggtcggcgtgcccgagccgctggcattgccc
ggtcagatgaagccattacccggtggcgatgcaaagtctgcaccggagcctgccgacgag
aagacgcgcgtgacccgcgccaacacagaggcgcgtatcgcgccgacgcgcgagggctat
gtgaacgccatccaggtctggccgttcaccgatggcgcgctgtaccaggtctatgcagcc
gtgggccgcgtaaccgtggtggcgctccagccgggcgaggaactggtgacggtggcggcc
ggcgataccgtgcgctggatcgtgggggatacctccagcggctccggcgcggacttgcgg
gtgagcgtgatggtcaagccgatccgctcagggctcaagaccaatctggtcatcaccacc
agccggcgcacctatttgttggaactgacctcgaccgagaagacgtggatggcgtcggtg
tcctgggagtacccgaaggacaggatgctggccctgcagcgccaggcgcaggcagccagt
gccgcggcgccggtcgatgccgggctgtcactggagaagatccgctttcgctacgccatc
agcggcagcaatccgccgtggaagcccgagcgcgtctttgatgatgggcagaaagtctat
gtgcagtttccgtcgggtattgcgcagggcgagttgccgccgctgtttgttatcggcgct
cagggcgacggccaactcgtcaactaccgtttccgatcgccgtacctgatcgtagatcgg
ctgttcggtgcagccgaattgcgcctcggcggagccaagggcgacgtggtgcggatcgag
cgcacggatggtgcgaaggggaaatga

DBGET integrated database retrieval system