KEGG   Stenotrophomonas maltophilia K279a: Smlt1285Help
Entry
Smlt1285          CDS       T00718                                 

Gene name
trbF
Definition
(GenBank) putative conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1285 (trbF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1285 (trbF)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1285 (trbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CAQ44834
UniProt: B2FTD7
Position
complement(1326979..1327683)
Genome map
AA seq 234 aa AA seqDB search
MRFKRPQVRYADTPQPATPYQSAAQMWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLV
WRSAQSIVTPYVIEVDNAGQVRAVGEAATPYQPSDAQVAYHLGRFIGLVRGLSIDPIVVR
QNWLDAYDYTTDKGAVVLNEYARGADPFSRIGKESVTVQVSSVTRASEASFNVRWTETRF
VNGALDRTERWNAVVSTVLQTPRTEQRVRKNPLGIYVNGLAWSRELEGNEGAKP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaaaagaccgcaggtgcgctacgccgatacgccgcagcctgccaccccgtac
caatccgccgcccagatgtgggacgagcgcatcggctcggcccgcgtgcaggccaggaac
tggcgcttcatggccttcggctgcctcaccttggccgtgctgatggccgggggcctggtc
tggcgctcggcgcagtccatcgtgacgccgtacgtcatcgaggtggacaacgcgggccag
gtgcgcgccgtgggcgaggccgccacgccgtaccagcccagcgatgcccaggtggcctac
cacctgggccgcttcatcgggctggtgcggggcctgtccatcgaccccatcgtggtgcgg
cagaactggctcgatgcctatgactacaccaccgacaagggcgcggtggtgctcaacgag
tacgcgcgaggggccgatccgttttcgcgcatcggcaaggagtcggtgacggtacaggta
tccagcgtgacgcgcgccagcgaggcgtctttcaacgtgcgctggacggagacgcgcttc
gtcaacggcgctctggaccgcaccgagcgctggaacgcggtggtttcgacggtgctgcaa
accccgcgcaccgagcagcgcgtgcgcaagaaccctctgggcatctacgtcaacgggctg
gcgtggagccgcgaactggaagggaacgaaggagcaaaaccatga

DBGET integrated database retrieval system