KEGG   Stenotrophomonas maltophilia K279a: Smlt1288
Entry
Smlt1288          CDS       T00718                                 
Symbol
trbE
Name
(GenBank) putative conjugal transfer protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1288 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1288 (trbE)
Enzymes [BR:sml01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smlt1288 (trbE)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1288 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 TraG-D_C CbiA AAA_16 NACHT FtsK_SpoIIIE TrwB_AAD_bind ABC_tran Zot DUF87 RsgA_GTPase T2SSE
Other DBs
NCBI-ProteinID: CAQ44837
UniProt: B2FTE0
Position
complement(1329746..1332232)
AA seq 828 aa
MLNLAEYRQRPARLADWLPWAGLVATGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRAAADYPHSDFPEPLSWLVDEERRAAFEGEAKDETLRGS
VSRPNGNHFESGYHLTLVYLPAEESRARAAGMLYENRPTEGVDWRERLTAFIAETDRFFD
LLDGVMPEIAWLDDSQTLTYLHSTISTRRYRVGLPEVPFHLDALLADAPLIGGLAPMLGD
QHLRVATVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKADAEKELSRLRRQWFAKRK
NVIALLRETIFQQESPLVDTDASNKSADADAALQELGSDQVAFGYLTATITVMDSDAAVA
DEKLRMVERVIQGRGFVTIPETLNAVDAWLSSIPGHAYANVRQPIVSTLNLAHLMPVSAV
WAGPERNDHLDGPPLIVTRTEGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFR
RYRGSRIFAFDMGRSMRATILGLGGEHYDLGMDGEIAFQPLARIEREGYRTWASEWIEGR
FRHEGVAVGPDEKVAIWSALGSLAGAPPEQRTMTGLSVLLQSNALRQALAPYVLGGAHGK
LLDADSDRLGAGSVQCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWQFL
DDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEP
QIRTIYEGFGLNSRQIEIVATAVPKRDYYYQSRLGNRLFDLDLGAATLAFAGASTPKDQR
DIDAVLAAAHSDSSAASSFAATWLRHRGLHWAAGLLSSFPSHPQEISP
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccagcggcccgcacggctggccgactggctgccctgg
gcgggactggtcgccacaggcgttgtgctgaacaaggacggttcctttcaacgcacggcc
cggtttcgtggccccgatctcgatagcgccacgcagggcgaactgatcgccacgtcagcg
cgcttgaacaacgcactgcggcggctgggttcgggctgggccttgttcatcgaggccgag
cgccgggccgccgccgactatccacactcggatttcccagaacccctgtcgtggctggtg
gacgaggaacgccgcgccgccttcgagggtgaggccaaagacgaaacgctccgggggagc
gtttcgcggccgaacggcaaccacttcgagagcggctaccacctgacactggtgtacctg
cctgcggaagaatcgcgcgcccgtgccgccgggatgctgtacgagaaccgtccgaccgaa
ggcgtggactggcgtgagcgcctgaccgccttcatagcggaaacggatcgcttctttgac
ttgctcgacggcgtgatgccggaaatcgcgtggctcgacgacagccagacgctgacctat
ctgcattcgaccatctccacgcggcgctaccgcgtgggcctgcccgaggtgccgttccac
ctcgacgcgctgctggccgatgcgccgctgatcggtggcctggcccccatgctgggcgac
cagcacctgcgcgtggcaacggtgcggggcttcccgacctcgacctggccggggattctg
gacgacctcaatcgcctcggctttgcctatcgctggagtacgcgctttctctgtctcgac
aaagccgatgcggaaaaggagctttcccgcctgcgccgccagtggttcgccaagcgcaag
aatgtgatcgccttgctgcgcgaaaccatcttccagcaggaatccccgctggtcgatacc
gacgccagcaataaatcggccgacgccgacgccgccttgcaggagctgggcagcgaccag
gtggccttcggctacctgacggcgaccatcactgtcatggactcggatgcggccgtggcc
gatgagaagctgcggatggtggagcgagtcatccagggccggggcttcgtgaccatcccc
gagaccttgaacgcggtcgatgcgtggctgtcctcgattccgggccatgcctacgccaac
gtgcgccaacccatcgtctcgacgctgaacctggcgcacctgatgccggtgtcggcagta
tgggctggccccgagcgcaatgaccacctcgacggcccaccgctgatcgtgacccgcacc
gagggcgcgacgccgttccggctggtcacgcacatcggcgacgtgggccacacgctggtg
gccgggccgaccggcatgggcaagtcggtgctgcttgccacgctggcaatgcagttccgg
cgctaccgtggctcgcgcatcttcgccttcgacatggggcgctcgatgcgcgccaccatt
ctgggcctgggcggcgagcattacgacctgggcatggatggcgagatcgctttccaaccc
ttggcccgcatcgaacgcgagggctatcgcacctgggcctccgaatggatcgagggccgg
tttcggcacgagggcgtggcggtcggcccagacgaaaaggtagctatctggtcggcgctc
ggcagtctcgccggcgctccgccggagcagcgcacgatgacgggcctgtcggtgctgctg
caatcgaacgcgctgcgccaggcgctcgcgccctatgtcctcggcggcgcgcacggcaag
ctgctggatgcggattcggatcgcctgggcgccggctccgtgcagtgcttcgagatggag
gagctgatgcacagcaaggccgccgtcatggccgtgctgcattacctctttgcgcgcttc
gatgaacgcttcgacggtgcgcccacgctgctgatcctcgacgaggcctggcagttcctc
gacgatccggtgtttgcggcgcgcatccgccagtggctgaagacgctgcgcaagaagaac
gtctcggtgatcttcgccacgcagtcgctggcggacatcaaggattcgagcatcgcgccg
gccatcatcgagagctgcgcgagccgcatcttcctgccgaacccgcaggcgaccgagccg
cagatcaggacgatctacgagggcttcgggctcaacagccgccagatcgagatcgtcgcc
acggcagttccgaagcgcgactactactaccagtcccgtctgggcaaccgcctgttcgac
ctcgacctgggcgccgcgaccttggcctttgcgggcgcctccacgccgaaagaccagcgc
gacatcgacgcggtgctggctgctgcgcattccgactcctctgctgcttcttcattcgca
gccacctggctgcgccatcgcggcctgcattgggccgccggtctgctgtcctcgtttcct
tcccacccacaggagatctcgccatga

DBGET integrated database retrieval system