KEGG   Stenotrophomonas maltophilia K279a: Smlt1289
Entry
Smlt1289          CDS       T00718                                 

Gene name
trbD
Definition
(GenBank) putative conjugal transfer protein
  KO
K20529  type IV secretion system protein TrbD
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1289 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1289 (trbD)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1289 (trbD)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: CAQ44838
UniProt: B2FTE1
Position
complement(1332243..1332515)
AA seq 90 aa
MNGLHDGLPGFEVPLHRSLTEPILMGGAPRTVAITNGTLATAVGLGLQMWIPGVVLWVVG
HALAVWGARVDPQFMQVFARHIKHRPLLDV
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaacggcctgcacgatggattaccgggattcgaggtgccgctgcatcggtcgttgacc
gagccgatcctgatgggcggcgctccgcgcaccgtagccatcaccaatggcaccttggcc
accgccgtgggcctgggcctgcagatgtggattccaggcgtggtgctctgggtcgtcggc
catgcgctggcggtctggggggcgcgtgtcgatccgcagtttatgcaggtcttcgcccgc
cacatcaagcaccggccgctgctggacgtgtga

DBGET integrated database retrieval system