KEGG   Stenotrophomonas maltophilia K279a: Smlt1290
Entry
Smlt1290          CDS       T00718                                 
Symbol
trbC
Name
(GenBank) putative conjugal transfer protein
  KO
K20528  type IV secretion system protein TrbC
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1290 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1290 (trbC)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1290 (trbC)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: CAQ44839
UniProt: B2FTE2
Position
complement(1332512..1332895)
AA seq 127 aa
MTQMIVPAFRISANPLRRPAWLDGLARPALQGLMLAALMLLLAGTAQAAGSSMPWEGPLQ
SILESIQGPVARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFS
FSGGAVV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgacgcagatgatcgttcctgctttccgtatttccgcaaatcctcttcgccggcccgcg
tggctggacggtctggctcgtccggccctgcagggtctgatgctcgcggcgctgatgctg
ctgctcgcgggcaccgcgcaggccgcgggttcctcgatgccgtgggaaggcccgctgcag
tccattctcgaatccatccaggggccggtggcgcggatcatcgcggtcatcatcatcatc
gccacgggtctggcgctggctttcggcgatacctcgggcgggttccgcaagctgatccag
atcgtcttcgggttgtcgatcgcgtttgccgcgtcctcgttcttcctgtcgttcttcagc
ttttccggtggggctgtcgtatga

DBGET integrated database retrieval system