KEGG   Stenotrophomonas maltophilia K279a: Smlt1421Help
Entry
Smlt1421          CDS       T00718                                 

Gene name
qseC
Definition
(GenBank) putative two-component system sensor histidine kinase
  KO
K07649  two-component system, OmpR family, sensor histidine kinase TctE [EC:2.7.13.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smlt1421 (qseC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sml01001]
    Smlt1421 (qseC)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sml02022]
    Smlt1421 (qseC)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Smlt1421 (qseC)
Protein kinases [BR:sml01001]
 Histidine kinases
  OmpR family
   Smlt1421 (qseC)
Two-component system [BR:sml02022]
 OmpR family
  TctE-TctD (tricarboxylic acid transport)
   Smlt1421 (qseC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2CSK_N HATPase_c HisKA HATPase_c_3 PspA_IM30 DUF3377
Motif
Other DBs
NCBI-ProteinID: CAQ44960
UniProt: B2FUF4
Position
complement(1466387..1467766)
Genome map
AA seq 459 aa AA seqDB search
MISGPPSLRRRLLAFLALPMLGLLTFNTILAYYVALDYSNRIHDRNLIDDTHSFAQMLST
MPVTSDLSPQARFLIEYDPDGHRYFNVDSSRMGTLSGNADFSPYAPSQDCTGVHPALYDG
NLNGQQVRMATVCTQAMNDPQDQLAVTVAESMADRRQRAREILMIIIPLMTMLALGTAAL
VWFGVTYGLRILTPLRTRLAQRRGELAPISDADVPEEIQPLISTIDDLFARQAEMITLQN
RFIADAAHQLRSPLAGMALHVDQALAHGDPDTVREALQHIRRLNQRTARVSTQLLALSRA
QTVPDTVEALDLCELVPQWVGMRVPEAIRDGIDLGYRGSPHPLRVLGNGAMLQEALDNLI
DNALRYAGRNATVTVGVHALDDNDVELYVEDNGPGVPDDVMPRLGERFFRAPGTAASGTG
LGLAIAHEAVEHFGGRLSFLNRPGGGLKVAITLPLLKAP
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtggaccgcccagcctgcgccggcgcctgctcgccttcctggcgctgccgatg
ctgggtctgctcaccttcaacacgatcctggcctactacgttgcgctggactattccaac
cgcatccacgaccgcaacctgatcgacgacacgcattcgttcgcgcagatgctgagcacc
atgccggtgaccagcgacctgtcgccgcaggcgcgcttcctgatcgagtacgaccccgac
ggccatcgctacttcaacgtcgacagcagccgcatgggtacgctcagcggcaatgccgac
ttcagcccgtatgccccttctcaggactgcaccggcgtgcatccggcgctgtacgacggc
aacctcaatggccagcaggtgcgcatggccacggtctgcacgcaggcgatgaacgatccg
caggaccagctggcagtgaccgtggccgagagcatggccgaccgccgacagcgggcgcgc
gagatcctgatgatcatcatcccgctgatgaccatgctggcgctgggcaccgcagcgctg
gtctggttcggcgtgacctacggcctgcgcatcctcacgccgctgaggacccgcctggcg
cagcgccgtggcgaactggcaccgatctccgacgccgacgtaccggaggagatccagcca
ctgatcagcaccatcgacgatctgtttgcccgccaggcggaaatgatcaccctgcagaac
cgcttcattgccgatgccgcgcaccagctgcgttcgccgctggcgggcatggccctgcat
gtggaccaggcgctggcacacggtgaccccgatacggtgcgcgaggcgctgcagcacatc
cgccggctcaaccagcgcactgcccgggtcagcacccagctgctcgcgctgagccgggcg
cagaccgtgcccgataccgtggaagcactggacctgtgcgagctggtgccgcagtgggtt
ggcatgcgcgtgccggaggcgatccgcgatggcatcgacctcggctaccgcggcagcccc
catccgctgcgtgtgctcggcaacggcgccatgctgcaggaggccctggacaacctgatc
gacaacgccctgcgttatgccggccgcaatgccaccgtcacggtgggcgtgcacgcgctg
gacgacaatgatgtcgaactctatgtggaagacaacggccccggcgtgcccgacgacgtg
atgccacggctgggcgagcgcttcttcagggcgccgggcaccgctgccagcggcaccggc
ctcggcctggccatcgcgcacgaggcggtagagcacttcggcggccgcctgagcttcctc
aaccgcccgggcggggggctcaaggtcgccatcacgctgccgctgctgaaggccccctga

DBGET integrated database retrieval system