KEGG   Stenotrophomonas maltophilia K279a: Smlt1722Help
Entry
Smlt1722          CDS       T00718                                 

Gene name
pcm
Definition
(GenBank) putative L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sml  Stenotrophomonas maltophilia K279a
Brite
Enzymes [BR:sml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Smlt1722 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 TehB Methyltransf_32 MTS
Motif
Other DBs
NCBI-ProteinID: CAQ45246
UniProt: B2FK95
Position
1768226..1768903
Genome map
AA seq 225 aa AA seqDB search
MSPRLRLQPEAVGIGMTSQRVRDRLVDRLREAGIVDESTLNAIRVVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVSPKKVLEVGTGSGYQAAVLGALGLEIYTVE
RIGDLLRQARKRFRALGMNIRTKHDDGRAGWAEHGPFDAIVVTAAAPALVDELVGQLAEG
GRLVAPVGGPGGQSLVQLDRRADGSIEQRVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtccacgcctgcgcctgcaaccggaagccgtcggcatcggcatgacctcgcagcgt
gtgcgcgaccgcctggtcgatcgcctgcgcgaggctggcatcgtcgacgagtcgaccttg
aatgcgatccgggtggtgccacgtcatctgttcatcgacgaagcgctggcgtcacgcgcc
tacgaagacaccgccctgccgatcggccacggccagaccatctcgcagccgtgggtggtg
gcgcgcatgaccgaagccgtgctgcaggtctcgccgaagaaagtgctggaagtcggtacc
ggctccggctaccaggccgccgtgctcggcgcgctgggcctggagatctacaccgtcgaa
cgcatcggcgacctgctgcgacaggcgcgcaagcgcttccgtgcgctgggcatgaatatc
cgcaccaagcatgatgatggccgcgcgggctgggccgagcacggcccgttcgatgccatc
gtcgtcaccgccgcggcgcctgcactggtcgatgaactggtcgggcagctggccgagggc
ggccgcctggtggcgccggtcggcgggccgggtgggcagtcgctggtgcagctggaccgc
agggctgacggcagcatcgaacaacgcgtgcttgcgccggtcaccttcgtgccgctgctg
tccggcatgctcgactaa

DBGET integrated database retrieval system