KEGG   Stenotrophomonas maltophilia K279a: Smlt1785Help
Entry
Smlt1785          CDS       T00718                                 

Definition
(GenBank) putative two component system histidine sensor kinase transcriptional regulatory protein
  KO
K15011  two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smlt1785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sml01001]
    Smlt1785
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sml02022]
    Smlt1785
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Smlt1785
Protein kinases [BR:sml01001]
 Histidine kinases
  Other
   Smlt1785
Two-component system [BR:sml02022]
 Other families
  RegB-RegA (redox response)
   Smlt1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: CAQ45306
UniProt: B2FL73
Position
complement(1833526..1834752)
Genome map
AA seq 408 aa AA seqDB search
MTGPDAPFLRTLCSLRWLAVGGQAATILVATWVLGLPLPQLPLWAGVAVLALFNIYTQLR
PEAADTAPLTAFGHILVDVIILTWMVGWSGGMANPFSSLFLILIALAAFALPLRWALAVA
LACLLGYAASGIFGQPLPDGYFRAQDLNRWGVVANFLISAAVVLTFSTRLALALRQRELE
LSALRERFARNEGIVALATHAASVAHELNTPLATMTLLADDVAERSEEPEVREDMETLRE
LLVQCRERVLALAAPASADAPGRSHSSAQQVLEQWRLVRPTIDLHRNDDAPLRLPLDPGV
GHLLMVLLNNAADAGEQAGRPRVDLDLRIEGDDLIGEVRDYGHGFNARAAVLPGKLFGSS
KSEGMGVGLALSHATIERLDGEMWMRPAQGAGSRVGFRLPLAPREETP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtcccgacgccccgtttctccgaaccctgtgcagcctgcgctggcttgcagta
ggcggccaggccgccaccatcctggtcgccacctgggtgctggggctgccgttgccgcag
ctgccgctgtgggcgggtgtggcggtgcttgccctgttcaacatctacacccagctgcgc
ccggaagcggccgacaccgcgccgctgaccgcattcggccacatcctggtggacgtgatc
atcctgacctggatggtgggctggagcggtggcatggccaatccgttcagctcgctgttc
ctgatcctgatcgcactggccgcgttcgccctgcccctgcgctgggcgctggcggtcgcg
ctggcctgcctgctcggctacgccgccagcggcatcttcggccagcccctgccggacggc
tatttccgcgcgcaggacctcaaccgctggggcgtggtcgccaacttcctgatctccgct
gcggtggtgctgaccttctccacccggctggcgctggcgctgcgccagcgcgaactggaa
ctgtcggcgctgcgcgagcgcttcgcccgcaacgagggcatcgtcgccctggccacccat
gccgcctcggtggcgcatgaactgaacacgccgctggcaaccatgaccctgctcgccgac
gacgtggccgaacgcagtgaagagccggaagtgcgcgaggacatggaaaccctgcgcgag
ctgctggtgcagtgccgtgagcgcgtgctggcgctggccgcaccggcctcggccgatgcg
cccggacgcagccattccagcgcgcagcaggtgctggagcaatggcgcctggtgcgaccg
accatcgacctgcaccgcaacgacgatgcgccgctgcggctgccgctcgacccgggcgtg
ggccacctgctgatggtcctgctcaacaatgccgccgatgccggcgaacaggccggccgg
ccgcgcgtggacctggacctgcgcatcgaaggcgacgatctgatcggcgaagtacgcgac
tacggccacggcttcaacgcgcgcgccgcggtgctgccgggcaagctgttcggcagcagc
aagagtgaaggcatgggggtcggcctggccctgtcccatgccacgatcgaacgcctcgac
ggcgagatgtggatgcgcccggcccagggggccggcagccgcgtcggcttccgcctgccg
ctggccccacgcgaggaaaccccatga

DBGET integrated database retrieval system