KEGG   Stenotrophomonas maltophilia K279a: Smlt3198Help
Entry
Smlt3198          CDS       T00718                                 

Gene name
sucB
Definition
(GenBank) putative dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00020  Citrate cycle (TCA cycle)
sml00310  Lysine degradation
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
Module
sml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smlt3198 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Smlt3198 (sucB)
Enzymes [BR:sml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Smlt3198 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAQ46639
UniProt: B2FLD2
Position
3241531..3242733
Genome map
AA seq 400 aa AA seqDB search
MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVLKEIK
FAEGSTVTSSQVVAIIEEGAVAAAPAPAAEAAPAAAAAPAAAAPAAAAAPAPAAKSAADA
LPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNFARNGGAGKAGGARPEERVPMTRIR
KRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDEFVKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERMSFADIEKTIADYAKK
ARDGKLGLDELQGGTFTVTNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAQNGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagccccggtactgcccgaatccgtcgccgacggcaccatcgcc
acctggcacaagaaggtgggcgacgccgtcaagcgcgacgaaaacctgcttgacctggaa
accgacaaggtcgtcctggaagtgccgtcgccggtcgacggcgtgctgaaggaaatcaag
ttcgccgaaggctcgaccgtgacctccagccaggtcgtggcgatcatcgaagaaggcgcc
gtggctgctgccccggctccggctgccgaagccgctccggctgcagccgctgccccggcc
gctgctgctccggccgctgccgccgctccggccccggccgccaagtcggccgccgatgcg
ctgccgccgggcgcccgcttcaccgccatcaccgaaggcgtgaacccggccgacgtcgac
ggcaccggccgtcgcggcgcggtgaccaaggaagacatcgtcaacttcgcccgcaacggc
ggcgccggcaaggccggtggcgcacgtccggaagaacgcgtgccgatgacccgcatccgc
aagcgcatcgccgagcgcctgatggagtcgaagaactccaccgcgatgctgaccaccttc
aacgaagtcgacctgtccaaggtctcggcggcgcgcaaggaactgcaggacgagttcgtc
aaggcacacggcatcaagctgggcttcatgagcttcttcgtgaaggccgccgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctaccacggc
tactcggacatctcgatcgccgtctcgaccgaaaagggcctggtcaccccggtcctgcgc
aatgtcgagcgcatgtcgttcgccgacatcgagaagaccatcgccgactacgccaagaag
gcgcgtgacggcaagctgggcctggatgaactgcagggcggtaccttcaccgtgaccaac
ggcggcaccttcggttcgctgctgtcgaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacgccatcaaggagcgtccgatcgcccagaacggccaggtcgtgatcgcg
ccgatgatgtacctggcgctgtcgtacgaccaccgcatcatcgacggcaaggattcggtg
cagttcctggtggacatcaagaaccagctggaaaacccgggccgcatgctgttcggcctg
taa

DBGET integrated database retrieval system