KEGG   Stenotrophomonas maltophilia K279a: Smlt3493
Entry
Smlt3493          CDS       T00718                                 

Name
(GenBank) putative ACR family transmembrane transporter protein
  KO
K09125  queuosine precursor transporter
Organism
sml  Stenotrophomonas maltophilia K279a
Brite
KEGG Orthology (KO) [BR:sml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sml02000]
    Smlt3493
Transporters [BR:sml02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Smlt3493
SSDB
Motif
Pfam: Vut_1
Other DBs
NCBI-ProteinID: CAQ46916
UniProt: B2FPS5
Position
3545109..3545894
AA seq 261 aa
MTPAPIERPLQDRAVLLFIVLAAFFCGNAVLAELIGVKIFALEDTLGIAPLNWNLFGQTG
SLSFTAGTLLWPVVFIMTDTINEFFGKRGVRFISWLAVVLIGYGFLFAFAAISLAPASWW
VTSMDGHGVPDYQAAFAAVFGQGMWTIAGSLVAFLLGQLIDVAVFHRIRQATGERHVWLR
ATGSTAISQVVDSFVVIWIAFVLGPQHWPTSLFLAVASVNYVYKMGFAVALIPLLYLMRR
AITRYLGADRAAALRAAAAAD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaccccggcgccgatcgagcgcccgctgcaggaccgcgcggtcctgctgttcatcgtg
ctggccgcgttcttctgcggcaatgcggtgctggccgagctgatcggggtgaagatcttc
gcgctggaagacacgctgggcatcgccccgctgaactggaacctgttcggccagaccggc
tcgctcagcttcaccgccggtaccctgctgtggccggtggtgttcatcatgaccgacacc
atcaacgagtttttcggcaagcgcggcgtgcgcttcatctcgtggctggcggtggtgctg
atcggctacggtttcctgttcgccttcgcggccatttcgctggcgccggccagctggtgg
gtcacctcgatggatggccacggtgtgcccgactaccaggccgcgttcgcagccgtgttc
ggccagggcatgtggaccatcgccggttcgctggtggccttcctgcttggccagctgatc
gacgtggcggtgttccaccgcatccgccaagccaccggtgaacgccacgtgtggctgcgt
gcgaccggatcgactgcgatctcgcaggtggtggacagcttcgtggtgatctggatcgcc
ttcgtgctgggcccgcagcactggccgacctcgctgttccttgcggtcgccagtgtcaac
tacgtgtacaagatgggctttgcggtcgccctgattccattgctgtacctgatgcggcgt
gccatcacccgctatctgggcgccgatcgcgcggcggcactgcgcgccgccgctgcggct
gactga

DBGET integrated database retrieval system