KEGG   Schistosoma mansoni: Smp_021830Help
Entry
Smp_021830        CDS       T01095                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
smm  Schistosoma mansoni
Pathway
smm00564  Glycerophospholipid metabolism
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smp_021830
Enzymes [BR:smm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Smp_021830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 8343453
NCBI-ProteinID: XP_018649665
GeneDB: Smp_021830
UniProt: G4VDV4
Position
2
AA seq 379 aa AA seqDB search
MKKNFLRQISTKENINTHLYHSRSPSVLKPIALQINLVIRSKLVLGTCGIVCGYVGFSLI
TDREDTPEYYPRHITAALCRHIPLNSLSKFWGRLAECHIPVFLRPIIYHSYSQLFRCDLS
EVENPDLRSYTCLSDFFIRKIATDKRPIHYSASLVSPVDGEVLHCGPINSKNAVLEQIKG
IRYSLDEFLGPMGSIESLNGKKSDRTLHQCVIYLAPGDCHRFHSPVEWIPTVRRHFPGRL
LSVRPNIAGRLPGLYTINERVVYLGEWDHGLMSFAAVGAFGVGNIHVNIDPTLITNKKED
NALRFRYSNTQIMINQEYKAPYLEAIFNDDMKLKKGDEFGYFRLGSTVVLVFEAPTNKMK
WCVKPGQRVKLGEPIIIDC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaacttcctgcgtcagatatcgacaaaagagaatataaatacacatctatat
cattcacgttcaccatcagttctaaagcctatagctcttcaaatcaacttggtaataaga
tccaagctagtcctaggaacatgcggtatagtgtgtggatatgttgggttttcgctgatt
acagatagggaagatacaccagaatactatcctcgtcatataactgctgcactttgtcgg
cacattccactgaacagtctgtccaaattttggggtcggttggctgaatgtcatatccca
gtattcttaagacctataatctaccattcctactcgcaattgttccgttgtgatttaagc
gaagttgaaaatcctgacttaagaagttatacgtgtctatcagacttttttattcgaaag
attgctacagataaacgacctattcattattcggcgtcattagttagtcctgttgatggt
gaagtactccattgtggtccaattaattcaaaaaatgctgttttagaacaaattaaagga
attcgttactcattagacgaatttcttggtccaatgggaagcatagaaagtttaaatgga
aagaaatctgatcgtacccttcatcagtgtgttatttatttagctccaggagattgccat
cgatttcatagtcctgttgaatggattcctacagtcagacggcattttccaggcagatta
ctttcagtacgtccaaatattgctggacgtctaccaggtctatatactatcaacgagcgt
gtagtttatttaggagaatgggatcatggattaatgtcatttgcagcagttggtgcattc
ggtgttggtaacatacacgtaaatatcgacccaacattaattacaaataagaaggaggat
aatgcattacgttttcgttattcaaatacacaaataatgataaatcaagagtacaaagca
ccatacttagaagcaatatttaacgatgatatgaaactaaagaaaggtgatgaatttggc
tattttcgtttgggatctacagttgttctggtttttgaagcacctacaaataaaatgaaa
tggtgtgtaaagccaggtcaacgagttaaacttggtgaaccaattataatagattgttaa

DBGET integrated database retrieval system