KEGG   Schistosoma mansoni: Smp_027920Help
Entry
Smp_027920        CDS       T01095                                 

Definition
(RefSeq) tubulin alpha chain,putative
  KO
K07374  tubulin alpha
Organism
smm  Schistosoma mansoni
Pathway
smm04145  Phagosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Smp_027920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:smm03019]
    Smp_027920
   03036 Chromosome and associated proteins [BR:smm03036]
    Smp_027920
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:smm04812]
    Smp_027920
   04147 Exosome [BR:smm04147]
    Smp_027920
Messenger RNA biogenesis [BR:smm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     Smp_027920
Chromosome and associated proteins [BR:smm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     Smp_027920
Cytoskeleton proteins [BR:smm04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Smp_027920
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_027920
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_027920
  Exosomal proteins of colorectal cancer cells
   Smp_027920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 8341751
NCBI-ProteinID: XP_018644183
GeneDB: Smp_027920
UniProt: C4Q4S5
Position
Unknown
AA seq 449 aa AA seqDB search
MRECISLHVGQAGTQMGDSCWELYCLEHGIQPDGKVPSDSTIKNDNDSFSTFFSETSYGR
YVPRAVFVDLEPSVIDRLRTGSYKQLFHPEQMISGKEDAANNYARGHYTVGKELVDEVLD
RIRKLSERCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKAKLEFAVYPAPHISTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYEICRRNLTIDRPTYSNLNRLIGQIVSSITA
SLRFSGALNVDLNEFQTNLVPYPRIHFPLTTYAPIISAEKAFHEQLSVSEITNSCFEPAN
QMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIANIKTRRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAISEAWARLNRKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALERDYEEVASDTVDAHSDDGGF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatgtatcagtctacatgttggtcaagccggaacccagatgggcgattcttgt
tgggagctctactgcctcgaacatggaatacaacctgatggcaaggtccctagcgactca
actattaaaaacgacaacgattctttcagtacgttcttcagcgagactagctacggtcgt
tacgtcccacgtgctgttttcgtagacttggaaccttcagttattgacagactgaggaca
ggctcttataagcagttgttccatccagaacaaatgataagcggaaaagaagatgctgct
aataattatgcccgtggccactacacagttggcaaagagttggtcgatgaggttctagat
cgtattcggaaattatctgaaaggtgcacaggactccaaggtttcttagtgttccattca
tttggtggagggacgggatctggttttacatctctattgatggaacgtctttcagtcgac
ttcggtaaaaaagctaagttagagttcgctgtatatccagctccccatatctcaacagct
gttgttgaaccgtacaactctattcttaccacacatacaacactagagcattcagattgt
gccttcatggttgataatgaagctatttatgagatatgtcgtcgaaatttaaccattgat
cgaccaacatacagcaatcttaaccggttaatcggacaaattgttagctccattactgct
tctctccgattcagtggtgctttgaacgtagatttgaacgagtttcaaaccaatttagtt
ccttatccccgtatccactttccattgacaacatatgcacccattatatcagcagaaaag
gcattccatgaacaactgagtgtttcagaaattacaaattcgtgttttgaacctgctaat
caaatggttaagtgtgacccaagaaatggaaaatacatggcttgttgtttgttataccga
ggtgacgttgttcctaaagacgtaaatgcagcaattgcaaatatcaaaactagaagatca
attcagtttgttgattggtgtcccaccggctttaaagttggaattaactatcaaccaccc
actgttgttcctggaggagatttggcaaaggtacagcgcgcagtgtgtatgcttagtaac
actactgcgatttcggaggcctgggctcgtttgaatcggaagtttgacctcatgtatgct
aaacgcgcttttgttcattggtatgttggcgaaggaatggaggaaggcgagttctcagaa
gctcgtgaggacctggctgctctagaaagagattacgaggaagttgcttcagatactgta
gatgcacactctgatgatggcggattttaa

DBGET integrated database retrieval system