KEGG   Schistosoma mansoni: Smp_033600Help
Entry
Smp_033600        CDS       T01095                                 

Definition
(RefSeq) ribonuclease III, putative
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smm03036]
    Smp_033600
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     Smp_033600
Chromosome and associated proteins [BR:smm03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    Smp_033600
   microRNA pathway
    RISC loading complex
     Smp_033600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 PAZ
Motif
Other DBs
NCBI-GeneID: 8353934
NCBI-ProteinID: XP_018645207
GeneDB: Smp_033600
UniProt: G4LVA9
Position
2
AA seq 928 aa AA seqDB search
MWIPPVSDNPTPFNIERELLPTVISEPSSKTSSLSSTTGTLDRDSLKENCPQYTPQNVRY
QHYPVPKVRCLSFPYQTLPSCGSAVYLYTWSLPRSDIMTQLCSLAAACFQDTSTTVGLLF
SKPISKKGYVCRIPLYLTRGMARSRVRLTGKFTLSEKELKCVESAHHVIAELITNIAHMS
HVGYKPSDPLLRAHFDRQNASTNIPESLRVVLFDRFGDLSFNPEKANILSLVTLIRLPDY
TVDYEALGALLEWSLCRDKGISTADDNFPTHVKPVHGIVPKWRIRLSQIPQDNWVGLVVK
PNHLPDSDPGMFSISKVSSETASSPVPETLASKLGDIQNVKGASPLTYSDYYRIKYQQMK
TISFTIDPSLPLFECLRITRHQNSTQVNAGLRKNKASIKPSLFLSDACLVHPLSSWIWFQ
VSLVPTILYQMSRALLASQLFTELNYELKSPQPFSQIRINSLTISNDSLSHTTILVPDRL
SVPVFLNGEPMEQNIFDFEVDRATSEIDKELDNKAHSESLEKSTICPHPNNLIEPTTLLG
ARDAVDLERLEFYGDSFLHFIATLCVYGTNPQDADEGCLSSKRGSLVSNAHLCDIACDLK
WYEYCTGQTFSPPEHFLPPCYSVASEACKYDPRLYTRLTDKSLADMVEALIGCFLLRSGL
SAAFNLLHYFQICPVSWSTLKNDKHYKVEAPWHFFLQPKLYSELNCGNALNASCRSLHIS
KEIILELNQRFFQLQEKLGYYFKGIELLAEAMTHQSSINKQYWGNYQRLEFLGDSILGHI
ISNYLFQKCPNSSPGALTTARSTVVSNINLANVVVEHDIYPFIDFGNCSLKACIDDIKSI
HRQTDSHFERIELITKKVSSGLNVKVLADVFESILGAIFVDSNGNHQVASSIIHRFLGKT
MTTQLLCHQSYMKIFMIRLHRLMVSAYV
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtggattcctccagttagtgataatcccacacctttcaacattgagagagagttgctt
cctactgtaatatcggaaccatcatccaaaacatctagtttatcttcaactactggcact
ttggaccgtgattctttaaaggagaactgcccacaatatactccacaaaacgtcagatac
cagcactatccggttccgaaggtcagatgcttgtcattcccatatcaaacacttccctcc
tgtgggtcggcagtgtatttgtatacgtggtctctcccaaggagtgacataatgactcag
ctatgttcacttgccgcagcatgttttcaagatacaagcacgaccgtcggacttttgttt
tctaaaccaatatccaaaaagggttacgtttgtcgaattcccctctacctaactcgcggt
atggctcgttcacgtgttcgattaactggaaaatttacactaagtgagaaagaattaaag
tgtgtcgaatcagctcatcatgtgatagccgaattaatcacaaatattgctcatatgtct
catgttggttataaaccatcagatcctcttctccgtgcccatttcgatagacaaaacgct
tcaacgaatatccccgaatctctccgcgtcgtactttttgatcgatttggtgacttatca
ttcaatcccgagaaagcaaatatcctgtcattggtgacgttgattcgactaccagattat
actgttgactatgaagcactcggcgcacttctagaatggtctctttgccgagataaagga
atttcaacagctgatgataattttccgacacatgttaaacctgtacatggtattgtgcct
aaatggcgaattcgattgagtcaaatacctcaagacaattgggttggtttggttgtcaaa
cctaatcacttaccggatagtgatcctggtatgttttccatctcaaaagttagttcggaa
actgcttcaagtcctgttcctgaaactcttgcttccaaacttggtgatattcagaatgtc
aaaggcgcttctcctctaacttattccgactactatagaattaaatatcaacagatgaaa
accatatctttcacaatagatccctcactaccattgttcgaatgtctgagaataacacgt
catcaaaattcgactcaagttaatgctggtctgaggaaaaataaagcatctatcaaacca
tcactgttcctatctgatgcttgtttagtgcatccattgtcatcatggatttggttccaa
gtttcattggtaccaacaattctctaccaaatgtcacgagcgttactagcttcacaactg
tttacagagttgaattatgaactgaaaagtcctcaaccattctctcaaattcgaataaat
tcattaactataagcaatgattcactttctcatacaaccatacttgtccctgatcgttta
agtgttcctgtttttttgaatggtgaaccaatggaacaaaatatctttgattttgaagtg
gatagagcaacttcagaaatagataaagaattggataataaagcccatagtgaaagttta
gagaaatctacaatttgccctcaccctaataatttgattgaaccaactacattactcgga
gctcgagatgcagtagatcttgaacgtttagaattttatggtgattcgttcctgcatttc
atagctacattatgtgtttatggcaccaatccacaagatgctgacgaaggatgtttaagt
tccaaaagaggttcactcgtatcgaatgctcatctctgcgatattgcttgcgacttgaaa
tggtatgaatattgtaccggtcaaacattttcgccaccagaacactttttacccccatgc
tactctgttgcatcggaggcttgtaaatatgatccacgtctgtatactcgtttaacagat
aaatctttggcggatatggttgaagcacttataggttgtttcttactacgttcaggacta
tctgctgcatttaatttacttcattattttcaaatatgtccagtgagttggagcacctta
aaaaatgataagcattacaaagttgaagctccatggcacttttttttacaaccaaaatta
tattcagaactaaattgtggaaatgctctcaatgcttcatgtagatccttacatatttct
aaggaaattatactggaattaaatcagaggttttttcagttacaagaaaagctaggttat
tattttaaaggaattgaattacttgcggaagctatgactcatcagtcatcaattaataaa
caatattgggggaattaccaaaggttagaatttcttggtgattccattttgggccatatt
atcagcaactatctgtttcaaaaatgtcctaattcatctccaggtgcactgactactgca
agatctactgttgtcagtaatattaatttagctaatgttgttgttgagcatgacatttac
ccgttcatcgattttgggaattgcagtctgaaagcatgcattgatgatataaagagtatc
catcgtcaaactgattcacattttgaacgtatcgagctaattacaaagaaggtttcttcg
ggactcaatgtcaaggtgttagctgatgtgtttgaatcgattctcggtgcaatttttgta
gacagtaatggtaatcatcaagtcgcgtcttctattattcatcgattcctgggtaaaact
atgacaactcaactgctatgtcaccaaagttacatgaagatattcatgattcggttacat
cgattaatggtaagcgcctatgtgtga

DBGET integrated database retrieval system