KEGG   Schistosoma mansoni: Smp_040770Help
Entry
Smp_040770        CDS       T01095                                 

Definition
(RefSeq) putative methionine-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smm  Schistosoma mansoni
Pathway
smm00450  Selenocompound metabolism
smm00970  Aminoacyl-tRNA biosynthesis
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Smp_040770
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Smp_040770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smm01007]
    Smp_040770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smm03016]
    Smp_040770
Enzymes [BR:smm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Smp_040770
Amino acid related enzymes [BR:smm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Smp_040770
Transfer RNA biogenesis [BR:smm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Smp_040770
 Prokaryotic type
   Other AARSs
    Smp_040770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 8347587
NCBI-ProteinID: XP_018651369
GeneDB: Smp_040770
UniProt: G4VFQ2
Position
3
AA seq 593 aa AA seqDB search
MEEITEPSSIHITDEDQKRAGDVFLDYNEFTKPVYETPKKPQPKHTGIRNVMITSALPYV
NNVPHLGNMIGSTLSANVFALYCDLAGYNVLSICGTDEYGTATEAKAVSENMTPRQICDK
FHKLHCDIYKWFQIEFDYFGRTTTDQHTEIVQEVFKRLWDKGFITEDSVEQLYCEKCSKF
LADRFVEGVCPLCKYHDARGDQCDKCGRLMNAVELIEPRCKMCSQKPVVRSSRHLFLDLP
KIENKLNTFVEQRINDSSCVWTSNACTISSSWLRDGLKPRCITRDLHWGVPVPLEAYKDK
VFYVWFDATIGYMSITANYTKHWKQWWQPSDNNEIELFQFMAKDNVPFHAIVFPACLLAA
DAGYTLVKHLLSTEYMNYENTKFSKSRGIGVFGDDAMKSGVISDVWRFYLLSLSFVSRFF
NSIIPSITKLEPVDTEFLARINKLFATYIHNMESCHLRDAIRNVLTIARLGNGYFQANQP
WVAVKKPETKERSGVVISVAANIACLLGAMIYPFMPTIGKQIWIEQCDLPISQMSFVQII
KNEFTVTRLLPDGHHIGKPVPLFRKIDTDEIKRLSQVYSGSSGASVTNGNDTK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaataacagaaccctcatctatacacattactgatgaagatcaaaaaagagct
ggtgatgtttttctagattataacgaatttaccaaacccgtatatgaaacaccaaaaaag
ccacaacctaaacatactggaattagaaatgttatgattacatcagcattgccttatgta
aacaatgtacctcatctgggaaacatgatcggatcgactttaagtgcaaatgtattcgct
ttgtattgtgatttggctggatataatgtgctatctatttgtggaactgacgaatatgga
actgcgactgaagcaaaagcagtctcagagaatatgactccacgtcagatctgtgataag
tttcataagttgcattgcgatatatacaaatggtttcaaattgaattcgattattttgga
cgaactactactgatcaacatactgagatagttcaagaagtatttaaacgcctgtgggat
aagggttttattactgaagattctgttgaacagttgtattgcgaaaaatgctccaaattt
cttgcagatcgttttgttgaaggagtttgccctttgtgtaaataccatgacgcacgaggt
gatcaatgtgataaatgtgggcgtcttatgaatgctgtcgaattaatcgaaccacgttgt
aagatgtgttctcaaaaacctgtggtgcgttcttcacgccatttgtttcttgatcttcca
aagattgaaaacaagttgaacacattcgttgaacaacgtattaacgattcctcttgtgtg
tggacctcaaatgcttgtactatatcaagttcatggttgagagatggtttaaagccaagg
tgtattacacgtgatttgcattggggtgtaccggttccattggaagcttataaagataag
gtgttttatgtttggttcgatgcaactattggttatatgtcgattacggcaaattacaca
aaacactggaaacaatggtggcaaccatctgataataatgaaattgaattattccaattt
atggcaaaagataatgttccatttcatgctattgtattccctgcatgtttattagcagct
gatgctggttatactcttgtaaaacatctactttctactgagtatatgaactatgaaaat
accaaattttcaaaaagtcgtggaattggtgtatttggtgatgatgcaatgaaatcaggt
gttatatcagatgtttggcgattttatttactatctctttcttttgtgtcacgatttttc
aattcgattattccgtcaataacaaaattagaaccagttgataccgaattcttggccaga
attaataaactcttcgctacttatatacacaatatggagtcatgtcatcttcgagatgct
attcgaaatgtattgacaattgctcgtcttggtaatggttactttcaggccaatcaaccg
tgggtcgctgttaagaaaccggaaacaaaagaacgttctggtgttgtgataagcgttgct
gctaatattgcttgtcttcttggtgctatgatttatccattcatgcctacaattggaaaa
cagatctggattgaacagtgcgatcttccaatatcccaaatgagtttcgtgcaaattatt
aaaaacgagtttacagtgacgaggttgttacctgatggtcatcatattggaaagccagtc
cctcttttccggaaaatagatactgatgaaattaaacgtttgtctcaagtttatagtggt
tcatctggtgcgtctgtgactaatggaaacgatacaaagtaa

DBGET integrated database retrieval system