KEGG   Schistosoma mansoni: Smp_041880
Entry
Smp_041880        CDS       T01095                                 

Definition
(RefSeq) putative peptide (allatostatin/somatostatin)-like receptor
Organism
smm  Schistosoma mansoni
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 8345593
NCBI-ProteinID: XP_018652268
GeneDB: Smp_041880
UniProt: G4VJR3
Position
4
AA seq 342 aa
MLHNTTTIDYSQLVGGFRAYLCPIIAMIGVIGNSFIILIFLKEKPLSRFSIYSIFLAIAN
MITLIMNTFIDDFLGRGLYYLTNHQFYFKLDTISKFWCKSVEYLSNTMYFTSSYLIVIFS
IDRLLTIHKPIKFYSIYHKHWALIACLLVYFIGIISNSPLLFVQTLMIDISSRTNFTCRM
ISEHPIAKFTIAFETIVTFTIPFCLVLFLNIFICIELWKLKVHRTALLPADCSRNRMEMG
RVFGHLALSTAFLLLYLPMVCFVLIRLSQTLSHVDRHKPYAMNIIDLSRLFSSVKDITYA
VNFFLYLIFLRNFRHGFQRLICTVYCKKVSSGSLHRPQRTED
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgttacataatactacaactatagattatagtcagttagttggtggttttcgtgcatat
ctatgtccaattattgcaatgattggtgtgataggaaatagtttcattatattgattttt
ttaaaagaaaaaccattatcaagattttcaatttattcaatttttttagctattgctaat
atgattacattaataatgaatacatttattgatgattttcttggacgtggtttatattat
ttaacaaatcatcaattctattttaaattagatacaatttcaaaattttggtgtaaaagt
gttgaatatctatcgaatacaatgtattttacatcatcttatttaattgttatattttca
atagatcgtttattaactattcataaaccaattaaattctattcaatatatcataaacat
tgggctttaattgcatgtcttcttgtatatttcattggaataattagtaattcaccatta
ttatttgtacaaacattaatgattgatatatcaagtcgaacaaattttacatgtagaatg
atatctgaacatccaatagcaaaatttacaatagcatttgaaacaattgttacatttaca
ataccattttgtcttgtattatttttaaatattttcatttgtattgaattatggaaattg
aaagttcatcgaacagctttattaccagctgattgttctaggaatcgtatggaaatggga
cgagtttttggacatttagctttgagtactgcattcttattattatatttaccaatggta
tgttttgtattaatacgattgagtcaaactttatcacatgtggataggcataaaccttat
gcaatgaatattattgatttgtctagacttttctcatctgttaaagatattacctatgca
gtgaacttcttcctgtatttaatattcttgcgaaattttagacatggatttcaacgttta
atctgtacagtatattgtaaaaaggtgtcatcaggatcattgcatagaccccaaagaact
gaagattga

DBGET integrated database retrieval system