KEGG   Schistosoma mansoni: Smp_043670.1Help
Entry
Smp_043670.1      CDS       T01095                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smm  Schistosoma mansoni
Pathway
smm00010  Glycolysis / Gluconeogenesis
smm00030  Pentose phosphate pathway
smm00051  Fructose and mannose metabolism
smm00052  Galactose metabolism
smm01100  Metabolic pathways
smm01200  Carbon metabolism
smm01230  Biosynthesis of amino acids
smm03018  RNA degradation
Module
smm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_043670.1
   00030 Pentose phosphate pathway
    Smp_043670.1
   00051 Fructose and mannose metabolism
    Smp_043670.1
   00052 Galactose metabolism
    Smp_043670.1
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Smp_043670.1
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Smp_043670.1
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Smp_043670.1
Messenger RNA biogenesis [BR:smm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Smp_043670.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 8350273
NCBI-ProteinID: XP_018652714
GeneDB: Smp_043670.1
UniProt: G4VKA5
Position
5
AA seq 797 aa AA seqDB search
MECRRKSNWFERRATEWLPGMEGKYVARGQFTGECIAVLTSGGDAQGMNAAVRAVVRMGI
YCGCRVFFIREGYQGLVDGGQNIQEASWADVSGILQLGGTKIGSARCMDFRERYGRLKAA
ENLVKNQITNLVVIGGDGSLTGANLFRAEWSSLLEELVTSNKISAESAKQFHRLNIVGLV
GSIDNDFCGTDMTIGADSALHRIIEATDAISTTAHSHQRCFILEVMGRHCGYLALVASMA
CEADWVFIPEMPPTDDWREKLCHKLRMNREHGQRVNIIMVAEGAIDRACKPITCEIVKNL
IVSELQLDTRITVLGHVQRGGSPSAFDRILGSRMGAEAVLALMDADRDPNLPSCVISLDG
NQAVRVPLVKCVDRTRQVAEAMKACDFDHAVELRGTSFMNNLATYIKLSKIEQPRQSVMS
SENNLRIGIVNVGAPACGINAVIRGFTRLGITKGYKVIGIHEGFSGLVKGDASEIQWADV
RGWVGMGGSMLGTRRDTPNGLGIDKVAAKFKELKLSGLLIIGGFEAYECMIELVEGREKY
PELCIPMAMVPATISNNVPGTDFSLGCDTALNEITSVLDKIKQSALGTKRRVFVVETMGG
YCGYLATMSALAGGADAAYIFEEPFTIDDLREDVVHLRAKIDDNVKRGLVLRAEYANKYY
TSEFIHQLYAQEGQGIFDCRCNVLGHMQQGDRPSPFDRSLGTKFASKAIDWLDEQINANI
RSDSTVYTPGHLCCTLIGIVRRQTTYSNIMELREHTDFVHRLPKEEWWLSLRPLMRIMAK
HDSLYESESIMAGTDRK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtagaaggaagtcaaattggtttgagcgccgagcaacagaatggctacctggt
atggaaggtaaatatgttgcccgaggacaatttacgggtgaatgtatcgctgttcttacg
agcggtggagatgcacaaggaatgaatgcagctgtacgagctgtagtccgtatgggaata
tactgtggatgtcgagtatttttcatcagagaagggtatcaaggtcttgtggatggtggt
caaaacattcaggaggcatcgtgggcagacgtttctggtattctccaattgggaggtact
aagattgggtcagctcgatgtatggattttcgtgaacgttatggacgtttaaaagctgct
gaaaatctagtcaaaaatcaaatcaccaatttagtggttattggcggtgatggttcttta
actggtgctaatctatttcgagctgaatggtcaagtctattggaagaacttgtcacatca
aataaaattagtgcagaaagtgccaaacaatttcatcgtttaaatattgtcggtttagtc
ggtagtattgacaatgatttttgtggtacagatatgacaattggtgcagactcagcattg
catagaattattgaagcgactgatgcaatctctactacagctcactcacatcaaagatgt
ttcattttagaggtgatgggtagacattgtggctatctagcacttgtcgcatctatggcg
tgtgaagctgattgggtatttataccagaaatgccaccaactgatgattggcgtgaaaaa
ttatgtcataaacttcgaatgaatcgtgaacatggacaacgtgtcaatataattatggtt
gctgaaggtgctatcgatagagcatgtaaaccgatcacttgtgaaatagtgaaaaattta
atagtatcagaacttcaacttgatacacgtataactgttttgggtcatgtccaacgtggt
ggttcaccatctgcatttgatcgtattttgggcagtcgtatgggagctgaagctgttcta
gccctaatggatgctgatcgtgatcctaatctaccatcatgtgttattagtttggatggt
aaccaagcagttcgtgtaccacttgtgaaatgtgttgacagaacacgtcaggttgctgaa
gcaatgaaagcttgtgattttgatcatgccgttgaactacgtggaacgagtttcatgaac
aatttagcaacgtatataaaactttcaaaaattgaacaaccacgtcaaagtgtcatgtca
tctgaaaacaacttgagaatcggtatcgtgaatgtcggtgctccagcttgcggtattaat
gcagtaataagaggatttactcgtttgggtatcactaaaggttataaggttatcggaata
cacgaaggattttccgggcttgttaaaggtgatgctagtgaaatacagtgggctgatgtc
cgtggatgggtgggaatgggtggttctatgttaggaacacgtagagatacaccgaatggt
ttgggtatagataaagtagcggcgaaatttaaagaattaaaattaagtggtctacttatt
attggtggctttgaagcgtacgaatgtatgatagaactggttgaaggacgtgaaaaatat
cctgaattatgtatacctatggctatggtaccagcgacaatttctaataatgttcctggt
actgatttctctttgggttgtgatacagctttaaatgaaataacctctgttttagataaa
attaaacaaagtgcattaggtacaaaacgtcgtgtatttgttgttgaaacaatgggcggt
tattgtggttatttagctacaatgagtgcattggctggtggagcagatgctgcttatata
tttgaagaaccatttacaattgatgatttacgtgaagatgtagtacatttacgtgcaaaa
attgatgataatgttaaacgtggtttagtactacgagctgaatatgctaataaatactat
acaagtgaatttattcatcaattatatgctcaagaaggtcaaggtatatttgattgccgt
tgtaatgtactaggtcatatgcaacaaggtgatagaccaagtccatttgatagaagttta
ggtacaaaatttgcatcgaaagcaattgactggttagacgaacaaatcaacgctaatata
cgttcagattctacagtctatacaccaggacatttatgttgtacattaattggtattgta
cgtcgtcagacaacttattcaaatattatggaattaagagaacatacagatttcgtacat
cgtttaccaaaagaagaatggtggcttagtttacgtccattaatgcgtattatggctaaa
catgatagtctttatgaatcagaaagtattatggctggtactgatagaaaataa

DBGET integrated database retrieval system