KEGG   Schistosoma mansoni: Smp_054160Help
Entry
Smp_054160        CDS       T01095                                 

Definition
(RefSeq) Glutathione S-transferase 28 kDa (GST 28) (GST class-mu), putative
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
smm  Schistosoma mansoni
Pathway
smm00480  Glutathione metabolism
smm00590  Arachidonic acid metabolism
smm00980  Metabolism of xenobiotics by cytochrome P450
smm00982  Drug metabolism - cytochrome P450
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Smp_054160
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Smp_054160
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Smp_054160
   00982 Drug metabolism - cytochrome P450
    Smp_054160
Enzymes [BR:smm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Smp_054160
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     Smp_054160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 8342765
NCBI-ProteinID: XP_018646799
GeneDB: Smp_054160
UniProt: P09792
Structure
PDB: 

Position
Unknown
AA seq 211 aa AA seqDB search
MAGEHIKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTD
DHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEK
EKITKEILNGKVPVLLNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTG
KYPEIHKHRENLLASSPRLAKYLSNRPATPF
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgagcatatcaaggttatctattttgacggacgcggacgtgctgaatcgatt
cggatgactcttgtggcagctggtgtagactacgaagatgagagaattagtttccaagat
tggccaaaaatcaaaccaactattccaggcggacgattgcctgcagtgaaagtcactgat
gatcatgggcacgtgaaatggatgttagagagtttggctattgcacggtatatggcgaag
aaacatcatatgatgggtgaaacagacgaggaatactatagtgttgaaaagttgattggt
caggctgaagatgtagaacatgaatatcacaaaactttgatgaagccacaagaagagaaa
gagaagataaccaaagagatattgaacggcaaagttccagttcttctcaatatgatctgc
gaatctctgaaagggtcgacaggaaagctggctgttggggacaaagtaactctagctgat
ttagtcctgattgctgtcattgatcatgtgactgatctggataaaggatttctaactggc
aagtatcctgagatccataaacatcgagaaaatctgttagccagttcaccgcgtttggcg
aaatatttatcgaacaggcctgcaactcccttctaa

DBGET integrated database retrieval system