KEGG   Schistosoma mansoni: Smp_123490Help
Entry
Smp_123490        CDS       T01095                                 

Definition
(RefSeq) putative nicotinamide mononucleotide adenylyltransferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
smm  Schistosoma mansoni
Pathway
smm00760  Nicotinate and nicotinamide metabolism
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Smp_123490
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Smp_123490
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Smp_123490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 8342436
NCBI-ProteinID: XP_018651174
GeneDB: Smp_123490
UniProt: G4VF56
Position
3
AA seq 288 aa AA seqDB search
MRMMELARDKIENLHLSTKESHHVLSGENNQCTQKEYNDDHLVNHDHRRVVVGGIFSPVS
NLYEKKGLLPASIRVELTRLACISASDWLAVSNWECSQSCWLRTRVVLDHIYSTLNNTYS
NLSNSDETDIDSVPRKKTCSVPGSFYHRSCYCRKNNTANVLLSKPCVKLVCGADLLESFK
TPKLWSAEDIETIVRDYGIICISRPSYDPLKIINESNILGKYKDNVSLVIDNCQNSLSST
FIRHALSHGESVRYLVPDRTLEYIYTHKLYGAKKRSVNQLESKTKIEV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgatggaactagcgagagataagattgaaaatttgcatttgtctacaaaagaa
tctcatcatgttttgtctggggagaataaccagtgcactcaaaaagaatataatgatgac
catttagtaaatcatgaccatcggagagtcgtcgttggtggtatattcagtcctgtgtcc
aatctgtatgaaaagaaaggtctcctaccagcctctatacgcgtcgagcttacacgatta
gcctgtatttctgcatctgattggttggccgtaagcaattgggagtgttcacaatcatgt
tggttgagaactcgagtggtgttagatcacatttatagtaccttgaataatacgtactcg
aatttgagtaacagtgacgaaaccgacattgactcagttccaaggaaaaagacttgctcc
gtaccaggcagtttttaccacagatcatgttactgtcgcaaaaacaataccgcaaacgtt
ttgctatcaaagccttgtgtgaagttagtttgtggtgctgatcttctggaatcattcaaa
actccaaagttgtggtcagcagaagatattgaaacaattgttcgtgactatggtataatt
tgtattagtcggccttcatatgatcccttgaaaattatcaatgaatcaaatattttgggc
aaatataaggataatgtaagtttggtgatagataattgtcagaattcactaagctctact
tttatacgtcatgctttatcacatggtgaaagtgtacgttacctcgttccagatcgtact
ttggaatatatttatactcataaattatatggtgccaaaaaaagaagtgttaatcaactt
gaatcgaaaactaaaatagaagtataa

DBGET integrated database retrieval system