KEGG   Schistosoma mansoni: Smp_123830
Entry
Smp_123830        CDS       T01095                                 

Definition
(RefSeq) putative collagen alpha-1(V) chain precursor
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:smm00536]
    Smp_123830
Glycosaminoglycan binding proteins [BR:smm00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   Smp_123830
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1 Wzt_C
Other DBs
NCBI-GeneID: 8348336
NCBI-ProteinID: XP_018647704
GeneDB: Smp_123830
UniProt: G4V6X6
Position
1
AA seq 1605 aa
MIFKQYNRRDDQLNTVPFRSILILLSLLIINSQQFNAQNITEEGNQNIKTIIEYKKNEDQ
FKDIIDLLQIVEIDKLDNYEVTRQYGFCPSSLIENPNTAYSYHRGDKLKLPAEKAFPATF
PQDFSILTTVRLKHEQIQKIFDVIDENGESQLAMSVGNNIALHYYLSGDSSSIVEFLNVK
LNDLRWHRIALSIKGDSVTLIIDCKVITSKLLNRSLTENLKFGKGMLYILQDKTGSASFS
GAIEQLLIIPTPSGAYDQCTVYSPCSETDKTGDEMQLQEPGRDGRNGIPGAPGLPGVPSH
ILMMPLPSFGKNELSRMASFRTTVQQAVMMLKGSRGQQGMIGLPGIQGPPGPRGSKGDQG
LFGEPGFIGPTGLRGPPGPIGPRGRPGVDGEIGASGLAGPKGLPGLPGLPGLPGHRGHKG
EIGPNGIKGDVGLRGVPGPYGRDGEVGPPGEPGSVGLQGPMGPVGPAGLRGLPGRIGPNG
LKGELGDSGEMGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPG
PQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKG
SKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSAGYPGAPGPKGSIG
PAGGIGSPGEKGDPGHMGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGDEGPTGPTGPPG
AAGPQGPRGSPGFVGVPGPPGLPGRPGPAGLLGDRGEPGEPGIPGEIGPIGMVGVPGQIG
EQGAPGERGPPGPRGPQGIPGKPGVEGIEGVQGEKGTKGAAGPPGPSGPVGLRGTRGPPG
PSGDPGSKGDEGRAGPQGSLGDKGDRGPPGPHGPPGPIGPVGPQGLPGSQGEPGDKGARG
PPGPIGETGEKGVQGLIGKPGLRGPTGADGEQGDQGSPGQQGTKGDRGEAGEQGSAGQQG
AAGSPGPQGMVGEPGEIGIAGVAGIKGIEGKVGPPGAPGPAGVQGSPGRSGPRGEPGIKG
VIGAEGPPGFPGPVGLAGAPGKMGIPGVPGPPGLPGLKGEQGKPGARGEQGAQGTTGPPG
PKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPMGPVGAPGLPGEPGAAGPPGKDG
VRGPIGLEGLFGDDGPPGPPGPVGVPGVQGPPGTAGETGPTGDPGDRGAAGPMGSPGERG
PPGITGAEGQVGPQGPEGEQGLQGPPGESGPKGNLGKTGSPGPIGPKGESGPKGVGGNPG
TVGPPGPKGEQGSIGDPGPTGKQGEMGDHGDQGPPGPRGPNGDEGESGPPGPTGPPGPPG
LQGPRGEQGHQGDPGPMGKQGPQGQVKITNNGENLRMRYKRSAAIQTEETLEQINQNIFG
RVDALNKKVRSRRYATGLSPQNPARTCKDVRLTNKFAQNDTYWVDPNEGSNKDAIRAKCT
FFDDGTVETCVDSSMDQLHNYGSHSQVNMLRIQHRYASQELEFLCDGTEIYGSWNSRTSQ
SDFNKATALLAHNERMLDLTSGERLGPGKYHMDKRNYRNNLDRVDTSIIVEYDGCQYLTK
GAATKLLIETRDLEVLPIIDFKVRNFDKQGTCSLSVNVGAVCYRT
NT seq 4818 nt   +upstreamnt  +downstreamnt
atgatctttaaacaatataatagaagagatgatcaattaaataccgtcccatttagatca
atattgatattattatcattattgattattaatagtcaacaattcaatgcacaaaatatt
actgaagaaggtaatcaaaatataaaaacaataattgaatataaaaagaatgaagatcaa
tttaaagatattatcgatttattacaaattgttgaaattgataaattggataattatgaa
gttacacgtcaatatggattttgtccatcatcattaatagaaaatccaaatactgcttat
tcatatcatcgaggagataaactgaagttaccagcagagaaagcattcccagctacattt
cctcaggatttttctattcttactactgtacgattgaagcatgaacaaattcaaaagata
tttgatgtaatagatgaaaatggggaaagtcaattggctatgtcagttggaaataatata
gctttgcattattatttatctggggattcatcgtctatagtggaattcctaaatgtcaaa
ctgaatgatctaagatggcatagaattgcattaagtattaaaggggattcagtcacatta
attattgactgtaaagttattacatcaaaattgttaaatcgttcattaactgaaaacttg
aaatttggtaaaggaatgctttatattctacaagataagacaggatcagccagtttttct
ggtgcaatagaacaactgctgattattccaacacctagtggagcatacgatcaatgtact
gtttattctccatgtagtgaaacggacaaaactggtgatgagatgcaacttcaagaaccg
ggacgagatggtcgcaatggaatcccaggagcccctggtttacctggtgtaccgagtcac
atattaatgatgccattaccaagttttggaaagaatgaattaagtcgtatggccagtttt
agaacaacagtacaacaagctgtcatgatgctaaaaggaagtcgaggtcagcaaggtatg
attggtctcccaggaatacaaggtccacctggaccaagaggttcgaaaggagatcaaggt
cttttcggagaacctggttttataggtccaacaggtttaagaggtcctccaggtcctata
ggtcctcgtggtagaccaggtgttgacggtgagataggagcaagtgggttagctggtccc
aaaggattacctggtcttcctggattaccgggtttacctggtcatagaggtcataaagga
gaaattggaccgaatggtattaaaggagatgttggacttagaggtgtgcctggtccttat
ggacgagacggtgaagtaggtcctcctggagagcctggatcagttggacttcagggccct
atgggaccagttggaccagctggattacgaggattacctggaaggattggaccaaatgga
ctcaaaggtgagttaggagactcaggtgaaatgggcccacctggtccacaaggtcctgtt
ggtccaccaggggtacctggacctcaaggcatacgtggactaactggaaagcctggagca
agaggaccacctggtgtaaccggactaccaggtagccctggaatgactggaaatcctgga
ccacaggggaatgcaggtccgaaaggagaaccaggattaactggagaacctggagatact
ggtcctgttggagcctcaggatataaaggtgaccgtggacctcgtggtttacctggagct
aaaggaactcaaggagcagctggtttaactggtgttcgtggagatagaggtgaaaaaggt
tcaaaaggtgaacgtggtctgcctggaccacgaggtagtgagggtcctgttggaataaaa
ggtgaacctggcataataggtgaacttggtcctcgtggattagaaggtcagaaagggaat
gaaggtcctcggggaagcgcaggatatcctggggccccaggtcctaaaggttccattgga
ccggcaggtggtattggaagtccaggtgaaaaaggcgacccaggtcatatgggaccatta
ggtttgagcggacctgttggaccacgtggagcacctggtccacgtggggcgccaggccag
tcaggaccagttggattcaaaggtgacgagggaccgacaggaccaactggtcctcctgga
gctgctgggcctcaaggtccaaggggttcacccggattcgtgggagttccgggtcctcca
ggtttacccggtcgaccaggaccagctggacttttaggagatcgaggtgaacctggtgaa
cctggtatacctggtgaaattgggccaataggtatggttggtgtacctggtcaaatcgga
gaacaaggggcaccaggtgaacgtggtcctccaggaccacgtggacctcaagggatccca
ggtaaacctggggtagaggggattgaaggagtacagggtgaaaaaggaaccaagggtgct
gctggtccacctggtcctagcggaccagttggattacgaggaacgcgtggaccaccaggt
ccatcgggcgaccccgggtcgaaaggagatgaaggtcgcgccggcccgcaaggaagcctc
ggtgataaaggtgacaggggcccacctgggccacatggaccacctggccccataggacca
gtcggaccacaaggattgccaggaagtcaaggtgaacctggtgacaaaggtgcacgtggt
cctcctggcccaatcggtgaaacaggtgaaaaaggtgtgcagggattaattggcaagcca
ggcttacgtggaccaacaggagccgatggagaacaaggcgaccaagggagtccgggacaa
caaggtactaagggagacagaggcgaagcgggtgaacaaggttctgccggacagcaagga
gcagctggatctccaggtcctcaaggtatggttggggaacctggagagataggaatagct
ggagttgcagggataaaaggtatagaaggcaaagttgggccaccgggggcacctggaccg
gctggtgtacagggctcacctggtcgaagtggtccacgtggggaaccaggtattaaagga
gtgatcggtgcagaaggcccacctggatttcctggacccgttggtttggctggggctcca
ggaaaaatgggaatacctggagtacctggtcctccaggattacctggattaaaaggagaa
caaggaaagccaggtgcacgtggtgaacagggggctcaaggtactactggaccacctgga
ccaaaagggatgaaaggaatgctcgggagacctggacgacaaggtcaacctggatctgcg
ggaccaccaggaatagttggagagccaggtgttcagggtgcacaagggccaatgggtcca
gttggtgctccaggattgccaggcgagccaggcgcagcaggtccgccgggaaaagatgga
gttagaggacctatcggtttagaaggactatttggtgatgatgggcccccaggaccacct
ggacctgtgggcgttcctggtgttcaaggtcctcctggaacagctggtgagactggtcct
accggagacccaggagatcgaggtgctgctggaccaatgggatctcctggtgaacgtgga
ccgcccgggatcacgggagctgaaggacaagtcggtcctcaggggcctgaaggagagcag
ggtcttcaagggccaccaggagaatctggaccgaaagggaatttaggtaaaacgggttca
ccaggtccaattggtccaaagggagagtctggtccaaaaggagtaggtggtaatcccgga
acggttggaccaccgggacctaaaggagagcaaggtagtataggagaccctggaccaact
ggaaaacaaggtgaaatgggtgatcatggggatcagggacctcctggtcctcgagggccc
aatggtgatgaaggagaatctggacctccaggtccaacaggccctcctggcccacctggt
ctacaaggtcctcgaggagaacaaggtcatcaaggtgatcctggaccaatgggtaaacaa
ggcccacaaggtcaagtgaaaataacaaataatggagaaaatctacgaatgagatataag
agatcagctgcaatacaaactgaagaaacacttgaacaaattaatcaaaatatatttgga
cgtgtagatgcactgaataagaaagtacgttcaagacgttatgcaactggtttaagtccc
caaaatccagcacggacatgtaaagatgttagattaacaaataaatttgctcagaatgat
acttattgggtcgatccaaatgaaggatcaaataaagatgcaattagagcgaagtgtaca
ttttttgatgatggcactgttgagacatgtgttgattcaagcatggatcaattacataat
tatggaagtcattcacaagttaatatgttacgtattcaacatagatatgcatcacaagaa
cttgaatttttatgtgatggaacagaaatctatggttcatggaattcacgtacaagtcaa
tcagattttaataaagcaacagctctgctagcacataatgaacgaatgcttgatttaact
tcaggtgaaagattaggaccgggaaaatatcatatggataagcgtaattatcgaaataat
ttagatcgtgttgatacaagtattattgtagaatatgatggatgtcagtacttgacaaaa
ggtgcagccactaaattattgattgagacaagagatttagaagtattgccaattattgat
tttaaagtacgtaatttcgataaacaaggaacatgttcattaagtgtaaatgttggtgct
gtatgctatcgtacatag

DBGET integrated database retrieval system