KEGG   Schistosoma mansoni: Smp_128100Help
Entry
Smp_128100        CDS       T01095                                 

Definition
(RefSeq) insulysin (M16 family)
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:smm01002]
    Smp_128100
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     Smp_128100
Peptidases and inhibitors [BR:smm01002]
 Metallo peptidases
  Family M16: pitrilysin family
   Smp_128100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 8353606
NCBI-ProteinID: XP_018644130
GeneDB: Smp_128100
UniProt: C4Q011
Position
Unknown
AA seq 226 aa AA seqDB search
MSIVDCINSADSSSPVVQKSANDLREYKVMRLCNRMKVLLISDPETDKSAVCLSVNIGSL
SDPKELPGLAHFCEHMLFLGTKSFPTENTYLKYITDHGGHCNAFTSPDKTSYVFDVAPES
LRGALDIFSQFFVCPLFTDSATEREVSAVQSEHEKDSSNDTRRLFQLERNLSKGGHDYTK
FFSGNRYSLFESSCAKSVNTREKLLQFYSTWYSSNLMSLVILGRGT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgtggattgtataaattcggcagattcctcatctccagtagtacaaaagtct
gcgaatgacttgagggaatataaagtgatgcgtttatgcaataggatgaaagtgcttctt
ataagtgatcccgaaacagataaatctgcagtgtgtttatctgtgaacattggttcgctg
tcggatccgaaagaactgcctggtctcgcacacttttgcgagcatatgttgtttcttggt
acgaaatcatttccgacagaaaatacctatttgaagtacataaccgatcatggtggtcac
tgtaatgctttcacgagtccagataaaacttcttatgtgtttgatgttgcacctgaaagt
ttgagaggagcgttggatattttctcacaatttttcgtgtgccctcttttcacagattct
gcaacagaacgtgaggtgagtgctgtacaatcggaacatgaaaaggatagtagtaatgat
actagacgtctttttcagctagagcgaaacttatcgaaaggtggtcatgattatacgaaa
ttcttctccggtaatcgatactcactatttgagtcgagttgtgcaaaatcagtgaatacg
cgtgaaaagttgttgcaattctattcgacatggtattcgtcaaatctgatgagtctagtt
attcttggaagaggtacataa

DBGET integrated database retrieval system