KEGG   Schistosoma mansoni: Smp_131220Help
Entry
Smp_131220        CDS       T01095                                 

Definition
(RefSeq) tripeptidyl-peptidase II (S08 family)
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:smm01002]
    Smp_131220
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:smm03110]
    Smp_131220
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     Smp_131220
Peptidases and inhibitors [BR:smm01002]
 Serine peptidases
  Family S8: subtilisin family
   Smp_131220
Chaperones and folding catalysts [BR:smm03110]
 Intramolecular chaperones
  Subtilisin family
   Smp_131220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 8349855
NCBI-ProteinID: XP_018653361
GeneDB: Smp_131220
UniProt: G4VKW7
Position
6
AA seq 1787 aa AA seqDB search
MINAFSSLLPKKQINSDIFLNDHAKCNGCVTRIAVWDTGIDPTAAGLQITPDGNRKIVDM
IDASGSGDVKMKYKRFIDQKHRIIETLTGRKVEIPSHWNPPDGIIRIGVKPASELFPKLL
MQRLRGENRDNFWRPCIKRIAANLAYDLTEAEEYLNQNLMSNHNGNKSWYQHYSPLEIIY
DCFVFHDGNEWVACIDTSPYNPNTKLSDLPLLRDYTVNHQYASFGEQTQLYYTVKIFDNG
KLLQIVTNNSSHGTHVAAIASAYFPNHHSETSSPSSGTVTNSTMLCDRDGVAPGAQIVSI
KISDSRLGPMETGISLLRAIRWTIELKCDIVNYSFGEQAIWPNIGRISKYLNRMIHKYGI
IMVASGGNNGPSLGSLSCPGGTVQGVIGVAPLVFPDMMHYLYCQPSDSSENAKPTAYNWG
SRGPAFDGALGICVAAPGGANTSIASWQLKPASVLSGSSMSAPMVTGGISLILSGLRHRY
TCSESQRLKIPSSLIYRCLMNTCKSFEHLSYLDQGYGLMQVDRAFCYVDRLIHKLYERNK
EITNLCTDFKNVNGVDHVDDISSPSSNVENSSIKLLPVPDPCIMYGWHIRLTVSGPGCTL
QNRGIWLRRGWLLSPRAVSNVASLPLLRYTVSMNIEFDEYVPIDIRRNMELHLTTEVASD
LDKLTNYNAWLQIASMITVTSTPRDINLVIDPNRFNQLLCEINEEISPSNDEYDATIKKT
QYSCNKCLGTNKNHSKGLLNQQEISSISENQLTSQLYAEQQHQQMQHNELSGFGWPSNLI
SSIKHPFHSLPVKSQKPYVMMLSFKAINEPEMGRLHRDCFSDHPRFLFSDRFDAKNKVRR
WFIEVPYGATAGILRLARIDDDGDKSCEFTITVNSPCIGMDSDSQEIRWTFVELNKFGQT
KSTLKRNDKYRPSLSSDDFDCASQFGFPIKWETDCLELTIAQHWGLEMPAIVIGELYFRG
LEPSLKNIVLNTSDRYCRIGLRSNFINESIQPDIWLTHWCLPVKPHDSKIFYLGHGINEL
LPNNCGSYALRLTYRFSCPFKTATTIISLPWLQDMLYTSDYSIHIFHIYDNCGRYIGAGE
YDGHRQQRPKFTFNLQKGDYKVIAQICHESGPSLKREPIKPLSVPCSPGTELSYMLSEYK
NADSTAINSTWSPLQSLQNTPILVSFRLTGGMELASGRKGGSCLTGQSIVQFEFSSFPSS
LNLNGTKFCSAMDPLTSDAKQTSMINRSILNNHSSNAIKNDQHTDNIESNRFELVKLLPC
LPNRVNAYETISIFLGLTNERSIEHQYKKNENSLNNNNHNHNSDCKDTDTSHTSTHPNHH
EEKTYQLDKPYENNNTNHGSSSNMCENLINNVKTDLTDERRGWDADNNPNNDVNDIEQKA
EVNDYTKSSSNESDSQSNDHNTLDSLNIIEKHAKISTIPNNIDFNVNHSNSETICGQQTL
GATASVVVITPPKSTTEHNLPNDSKNQTSSSFKVNSYNSDEFSTILCKIHVDLCSLDKPF
IMTPMKKNLKINAPTTTDGTCVFASSCSNLSLNGECTLSSPLSSRLELCKSDSLCNLLKP
EPPDGCVVSQSNRGVAKSENKDNPKPFGINLNEFKLRLIDILTRYGRLIAERLICLNYIH
NQLTYSNQYKWSLYNFMESKFQYLDKIYERLIKLTSQTALGTDSIGFNIQLGNHALPGWL
LLSTDCKLNKNDENLSSMNYGSIDEPPVGALKGIINCSFPSSSTSSFGVLRQCHATLENS
LEIAKSTLPWLTWLLKQIGWSDLAIYLNQQAPILFPQRDYSLLGENN
NT seq 5364 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgctttttcgagcctattgcctaagaaacaaattaattccgatatttttctg
aacgaccatgctaaatgtaatggctgcgttactagaattgcagtgtgggacacgggtatt
gacccaacagctgcaggtctacaaattacgcctgatggaaatcgaaaaattgtggacatg
attgatgcttcaggttctggagatgtgaaaatgaaatataagcgattcattgaccagaag
catcgtattattgaaacactgaccggtcgtaaagttgagataccgagtcattggaatcct
ccagatggcataatacgaattggtgtgaagccagcatctgaactattcccgaaacttttg
atgcaacgattacgtggcgaaaatcgagataatttctggcgaccatgtattaaacgaata
gctgcaaatttagcttatgatttgactgaagctgaagagtatttaaatcagaaccttatg
tcaaatcataacggaaataaaagttggtatcaacattattcacctttggaaattatatac
gattgttttgtttttcatgatggcaatgaatgggttgcttgtatagatacaagtccatac
aatccaaatacaaaattgtccgatttaccattattacgagattatacagttaaccatcaa
tatgcatcatttggtgaacaaacccaactttattatacagtgaaaatttttgacaatgga
aagttactacagattgttacaaataacagtagtcatggcactcatgttgcagcgattgcc
tcagcgtattttcccaatcatcattcagaaacttcatctcctagtagtggaactgttact
aattctaccatgttgtgtgatcgtgatggagttgcacctggtgcacaaattgtaagcatt
aaaatttcagacagtcgtttaggtccaatggaaacaggaattagtttattacgtgccatc
cgatggacaattgaactaaagtgtgatattgtaaattacagttttggtgaacaagcaatt
tggccaaatattggacgtatctcaaagtatttgaatcgaatgattcataaatatggtatc
attatggttgcaagcggtgggaataacggacctagtttgggttcattaagttgtccaggt
ggtacagttcaaggtgtaattggtgttgcacccttagtatttcctgacatgatgcattat
ctatattgccaaccaagtgattcatctgaaaatgctaaaccaactgcttataattggggt
agtcgtggtccagcatttgatggggctttaggtatatgtgttgctgctcccggtggtgct
aatacgtctatagctagttggcaattaaaaccagccagtgttctgagtggaagttcaatg
agtgcacccatggttaccggtggaattagccttatactctccggattgcgtcatcgatat
acgtgttctgagagtcaacggttgaaaatcccatcatcacttatttatagatgcttaatg
aatacttgtaaatcatttgaacatttatcttatttggatcaaggttatggtttgatgcaa
gtagacagagccttctgttatgtagatcgtctcatacataaattatatgaacgaaataaa
gaaataactaatctgtgtacagatttcaagaatgtaaatggtgttgatcatgttgacgat
atatcctcgccatcatctaatgttgaaaactcgtcaataaaattattacctgtacctgat
ccatgtataatgtatggttggcatattcgattaactgtttctggacctggttgtacacta
caaaatcgtggaatctggttaagacgtggttggttactgagtccacgagccgtgagcaat
gtggcctcattacccttgttacggtacaccgtgagtatgaacattgaatttgacgagtat
gtccctattgatattcgacgaaacatggaattgcatttaactacagaggtagcttctgac
ctagataaactaacaaattataatgcttggttacaaattgcatcaatgataactgttaca
agtacaccaagagatattaacttagttatcgatccaaatcgatttaatcaattattatgt
gaaataaatgaggaaatttctccctcaaatgatgaatatgatgcaacaataaaaaaaaca
caatattcatgtaataaatgtttagggactaacaaaaaccattctaaaggactcctgaat
caacaggagatatcttcgatatcagagaatcaattaacgtcacaactatacgcagaacaa
caacatcagcagatgcaacacaatgaactatcaggtttcggttggccatcaaatctaatt
tcttcaattaaacatccttttcattcattgcctgttaaatcacagaaaccatatgttatg
atgcttagttttaaagctattaatgaaccagaaatgggcaggttacatagagattgtttt
tcggaccacccacgtttcttgttctcagatagatttgatgctaaaaataaagtaagaaga
tggttcattgaagttccgtatggagctactgcggggattttacgtttagcacggatagac
gatgatggagataaatcgtgtgaatttacgattactgttaattcaccatgtattggtatg
gattcggatagtcaagaaattcgatggacatttgttgaattaaataaatttggtcaaact
aaatcaactttaaaacgcaatgataaatatagaccatcattgagttcagatgatttcgac
tgtgcatcacaatttggatttcctattaaatgggagacagattgtttagaattaactata
gcacaacattggggattagaaatgccagctattgtaatcggtgaattgtattttcgtggt
cttgaaccgagtcttaaaaacattgtattgaatacaagtgatcgttattgtcgtatcggt
ttacgttctaattttattaatgaatcaatacaaccggatatatggttaactcattggtgt
ttacctgtcaagcctcatgattcgaaaattttttatttaggtcatggaataaatgaactg
cttccaaacaattgtggttcgtatgctctgcgtttgacgtatcggtttagttgtccattc
aaaacagctacaaccatcatttctttgccttggttacaagatatgctttataccagtgat
tattcaattcatatatttcatatttatgataattgtggccgatatattggtgctggtgaa
tacgatggacatcgtcaacaacgtccgaaatttacttttaatttgcaaaagggtgattat
aaagtgattgcacagatttgtcatgaaagcggtccatctttaaaacgtgaaccaataaaa
ccattatctgtcccttgttcaccagggactgaactgtcgtatatgttaagtgaatacaag
aatgctgattctaccgcaatcaattccacttggtcaccgttacaatcattacaaaacact
ccaatattagtaagttttcgtttaactggtggaatggaattagccagtggtagaaaaggt
ggttcttgtttaactggacaaagtattgtacaatttgaattcagctcatttccttcatca
cttaatttgaacggtaccaaattctgttcagctatggatcctttaacatccgatgcaaaa
caaacttcaatgatcaatcgtagtatattgaataatcattcatcaaatgcaattaaaaat
gatcaacacacagataatattgaatcaaatcgttttgaattggtaaagctgttaccatgt
cttcctaatcgagtgaacgcatacgaaacaattagtatttttctgggtcttacaaatgaa
cggtcaattgaacatcaatataagaagaatgaaaattcgctaaataataataatcataat
cataatagcgattgtaaggatacagacacatcccatacatcaactcatccaaatcatcac
gaagagaaaacataccaattggataaaccttatgaaaataataatactaaccatggttca
tcatcgaatatgtgtgaaaacttgataaataatgtgaaaacagatttaaccgatgagcgt
agaggatgggacgctgataataatccaaacaatgatgtaaatgacattgaacaaaaggca
gaggttaatgactacacgaaatcatcatcaaacgaatcagattcacaatcgaatgatcat
aatacactagattcattgaatatcattgaaaaacatgctaaaatctcgacaatacccaac
aatattgactttaatgtcaatcattcaaacagtgaaacgatatgtggtcaacaaacatta
ggggcaacggcatcagtagtagtgataacaccaccgaaatccaccacggaacataatcta
ccaaatgatagcaaaaatcaaacatcatcatcattcaaggtgaatagctataattcagat
gaattcagtactattctttgtaaaattcatgtagatttatgttcattggataaaccattc
ataatgacacctatgaagaagaatcttaagatcaacgctccaaccactactgatggtaca
tgtgtttttgcaagttcatgtagtaatctatcattgaatggcgaatgtacactatcgtct
cctttatcatcacgattggaactgtgcaaatctgattctttgtgtaatcttcttaaacct
gaacctcctgatggatgtgttgtaagtcaatctaatcgaggagtagccaagtctgaaaac
aaagacaatccaaaaccctttggaattaatttaaacgaatttaaattacgtcttattgat
atactaactcgttatggtcgtcttattgctgaacgtttaatttgtttaaattatatacat
aatcaattgacttattcaaatcaatataaatggtcattatataactttatggaatcaaaa
tttcaatatcttgacaagatttatgaacgtttaattaaattaactagtcaaacagcttta
ggcactgattctattggattcaatattcaattaggtaatcatgcattacctggttggctt
cttttatcaactgattgtaaattgaataaaaatgatgaaaatctgtcatctatgaattat
ggttcaattgacgaacctcctgttggagcattaaaaggtattattaactgttcatttcca
tcttcatctacatcttcatttggagttctacgtcaatgtcatgctactttagaaaattct
ttagagatagctaaatcaactcttccttggttaacatggcttctaaaacaaattggttgg
tctgatttagcaatttacttaaatcaacaagctccaatcttatttcctcaaagagactat
agtctattaggtgaaaacaattaa

DBGET integrated database retrieval system