KEGG   Schistosoma mansoni: Smp_135160Help
Entry
Smp_135160        CDS       T01095                                 

Definition
(RefSeq) putative dual specificity protein phosphatase
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smm01009]
    Smp_135160
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Smp_135160
    3.1.3.48  protein-tyrosine-phosphatase
     Smp_135160
Protein phosphatases and associated proteins [BR:smm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    Smp_135160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT Rhodanese
Motif
Other DBs
NCBI-GeneID: 8348990
NCBI-ProteinID: XP_018655068
GeneDB: Smp_135160
UniProt: G4VQ48
Position
W
AA seq 483 aa AA seqDB search
MSSSKVIVIERPENSKSFNHDEISNTCGMVKSEIILSRLRKAKELSLDSHLIIVDMRETR
LYQSGHILTARSANCYTKTMAKRAIQSWDIWYTETHGCPAPYMESPVSFISQISLVKPAI
VVYDQRSNFAAISTLKDKKVRAELHFISALLDRGNRVYMIDDNFESNDTEKLISCLKDCS
RDETLVVRIKQTPLRVNEIQQNNDDVLSASISQILPFLYLGNARDSQDVDLIRQLNVTHI
INVTDTLPMPFRKLNRIQYLHIPATDTTKQNLLPSFDRAVQFIEKARKHNGIVLVHCLAG
VSRSVAVVIAYLLYNNRGLNVYKALEFVQARRSVAGPNLHFMGQLQAYYHDLHSRKSNIF
SDKLNMKSKDKLTKRNSAENLTGKSKRNNLPRSVSLSSNWIQSQSRSSSVLCKVSSSSNT
TTPGYVTSKLSIYDLGNIKINSKISMNSTWSVSTTCTNHQRSLVRKCSHESKTTSMIPIK
TQK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagttcgaaagttattgttatagagagacctgaaaactcaaaaagctttaaccat
gatgagatcagcaatacgtgtggcatggtgaaatcagaaatcatactttctagattacgt
aaagccaaagaattatcattagattctcatctaatcattgtggatatgagagagacgaga
ctttaccaatctggtcacatacttacagctcgttcagcaaactgttacacaaaaactatg
gccaaacgagctatccagtcatgggatatttggtatacagaaacacatggatgccctgca
ccttatatggaatctccagtgtcatttatttcacaaatatcactggttaaacctgccatt
gtggtttatgatcaacgtagtaattttgcagccatttcaacacttaaagataaaaaagtt
cgagctgaattgcattttatttctgctctactagatcgaggaaatcgagtttacatgatt
gatgataattttgaatccaacgatacagaaaaacttatttcttgtttaaaggattgttcc
cgtgatgaaacattagttgtacgaattaaacaaacaccattaagagtaaatgaaatacaa
caaaataatgatgatgtattaagtgcaagtatatcacaaattttaccatttttatattta
ggtaatgcacgtgactcgcaagatgttgatttgattagacaattaaatgtaacacatata
attaatgtgacagatacattgcctatgccattcagaaaattaaatcggatacaatatttg
catatacctgctacagatactacaaaacaaaatctactcccatctttcgatcgagctgta
caatttatagaaaaagcaagaaaacataatggtatcgttttagtccattgtttagccggt
gtttcacgatcagttgcagttgtcattgcctatcttctatacaataatcgtggattaaat
gtttacaaagcattagaatttgtacaagcacgtcgttctgttgctgggccaaatttacat
tttatgggacaacttcaagcttattatcatgatttacatagtcgtaaatcaaatattttc
tctgataaattaaatatgaaatctaaagataaattaacaaaacgtaatagtgcagaaaat
ttaactggcaaatcgaaaagaaacaatctacctcgtagtgtaagtttatcatctaactgg
atccaatcacaatcacgttcctcttctgtactatgtaaagtttctagttcaagtaatact
actactccagggtatgttacttcaaaattatctatttatgatttgggtaatattaaaatt
aacagtaaaatatctatgaattcaacatggtctgtaagtacaacatgtacaaatcatcaa
cgttcacttgttcgtaaatgttcacatgaatcaaaaacaacttcaatgataccaatcaaa
actcaaaagtaa

DBGET integrated database retrieval system