KEGG   Schistosoma mansoni: Smp_157510Help
Entry
Smp_157510        CDS       T01095                                 

Definition
(RefSeq) putative atp-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
smm  Schistosoma mansoni
Pathway
smm03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Smp_157510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:smm03041]
    Smp_157510
Enzymes [BR:smm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Smp_157510
Spliceosome [BR:smm03041]
 Complex C
  Other components
   Step II factors
    Smp_157510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 AAA_7 PhoH
Motif
Other DBs
NCBI-GeneID: 8344740
NCBI-ProteinID: XP_018649337
GeneDB: Smp_157510
UniProt: G4VAG5
Position
1
AA seq 1569 aa AA seqDB search
MSDSIETHNLEDLLPVEIDTVMTTKSRLPEFDRSDPELWFAQLEHYFTRHNIKSEGIRYR
DLCSILPPSIAKEVRDLILDPPSPQPYTILRREIMNRLSLSDSQRIQRLFQGETLGDRSP
SQFLRHLQVLMGDNTVGEAVLKQGWIQALPCYVQHCLDAQDPETSLSHLARIADRIMERG
PPTGPGTINHTQKVESAKDPVIEGLIASVKSLTEAVTRMQMGHRNRSKSPQRPRSKSQNS
GFPTSTSESSYSTAIMVVESDDSGFRQLEYFSLVSKVCTELTNHLGLDDKVLAEFVIHLA
KKNPTFEKFKSALERKGAEFTDPLIASILRLVEKMLPKKEKLIKKKALTLSSNKKDSEVD
VVKNKLELRKRLLPALCMPNKDPNDERLNLESENVEPCGDTDKKDGIRNKFVHPDELEEE
SRNNSDINDKNNCVDDVEALAMIKDLELLLSDAKEASLSKSKPCDEKKSEDRRARRSHSK
SPHRSRHSNRRAHQRNPDSSSDYRGHRKKSRSPHGKESRSPSPHSSRHRSKDCSPASKSS
YHRDRSRADRTSPKRYSHGSNSPNYENKRLKDLPSEPVVGDIYRGRVTNVLAFGAVVQLD
GLRKRWEGLVHISQLRQEGRVASVGDVVNRNQKVWVKVISFTGTRTGLSMREVDQETGTD
LNPSRLPEKKFNNSSELLDKDKIRLVDEEDIDGVRNPDRPAANSGPGFFGRRKEMGFEED
IESGPKRKVQRISSPERWELKQMMSAGVIEKTELPDFDEETGLLPREDEESDEDIEIELV
EDEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREMKQQERQNQVTAER
ETAPERMGKDWHDPMGFTLDNEPQFSGSRSADQFKDVPEWKRAVQGGTRTGAVGKKIVRS
ILEQRQALPIFRLKDELMKAVNDNKVLIVIGETGSGKTTQITQYLAEAGYVNTGRIGCTQ
PRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLR
QYSVIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTI
PGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCELLYERM
KALGSEVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVIDP
GFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLATNV
PEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLG
RRMAEFPLEPMLSKMLIMSVHLQCSEEVLTVVSMLSVQNVFYRPKEKTELADQRKAKFHQ
PEGDHLTLLAVYNAWKNNKFSAPWCYDNFLQARTLKRAQDVRKQLLGIMDRHKLDVVSCG
KKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMT
TKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRTKKSMRIEPLFSKFEEKDSWRISRVP
RKFHVKVTF
NT seq 4710 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactcaatagaaacccataatctggaggatttgttaccagtggaaatagacact
gttatgactacgaaatcccgacttccagaatttgatcgtagtgatcctgagttgtggttt
gctcaactagagcattatttcacgagacacaacatcaaatctgaagggattcgctataga
gacttgtgttctatccttcctccttcaatcgccaaagaagtccgtgacttgattttagat
ccaccatcaccacaaccatacaccatcttaagacgagagataatgaaccgtttatcatta
tcagatagtcaaagaatccaaagactttttcaaggtgaaacactaggtgaccggtcgccg
tcacagtttttgcgtcacctccaagtgttgatgggtgataacacagtgggtgaagcagtc
ctaaaacaaggatggatacaagctctcccatgctacgtccaacactgtttggatgcacaa
gatcctgaaacctcattatctcatttagcgcgtatagccgacagaataatggagagaggt
cctccaactggaccaggcacaataaatcacacacaaaaagtagaatcagcaaaagacccc
gtcatagaaggactcattgcgagtgttaagagtctcactgaggctgtcaccagaatgcaa
atgggtcatagaaacaggagcaagtcaccacaacgaccacgatccaagtcacaaaacagt
ggatttcctacttctacttcagagtctagttattcaaccgccatcatggttgtcgaatca
gacgattctggttttcgccaactggaatacttctctttagtttcaaaagtttgcacagaa
ttaacaaatcacttgggtttagatgataaagtcctggctgaatttgttattcatttggct
aagaaaaatccaacgtttgaaaaattcaaaagtgctttggaaaggaaaggcgcggagttt
acagacccattaatagccagtattttacgtctagttgagaaaatgcttccaaagaaggag
aaacttattaaaaagaaggcactaacattgtcatccaacaagaaagattcagaggtagat
gttgtcaaaaacaaactggaattaagaaagcgacttttacctgcgttgtgtatgccaaat
aaagatccaaacgatgagcgattaaatttagaatctgaaaatgtagaaccatgcggtgat
actgataaaaaggacgggattcgtaacaaattcgttcatcctgatgaactggaagaggaa
tcccgtaataatagcgatatcaatgataaaaataattgcgtagatgatgttgaagccttg
gctatgattaaagacttagaattattgttatccgatgctaaagaagcatccttatccaag
tcaaaaccatgtgacgaaaagaaaagtgaagatagacgtgctcgtcgttcacattctaaa
tctcctcatcgttcacgacattcaaacagaagagctcaccaaagaaatcctgattcatct
agtgattatcgtggtcatcgtaaaaagtccagatcacctcatggaaaagaatccagatcc
ccatcgccccactcctctagacatcgatctaaggattgttctccagctagcaaatcgtct
tatcatagagaccgatcacgagctgatcgtacttcacctaaaaggtattcccatggttca
aatagtccaaattatgaaaataaacgactcaaagatcttccttcagaacctgttgtgggc
gatatctatcgtggtagagttacaaatgtgctagcattcggagctgttgttcagttagat
ggacttcgtaagagatgggaaggtctggtgcatatttctcagctacgtcaagaaggccgt
gtagctagtgttggcgatgttgttaatcgtaatcaaaaggtgtgggtaaaagttatctcg
ttcactggtactcgaactggtcttagtatgcgtgaggtggaccaagagactggcaccgat
ttgaatccttcacgcttacctgagaagaagttcaataattctagtgaattgttagataaa
gataaaatacgtctcgtagatgaagaggatatcgatggtgttcggaatcctgatcgtcct
gcagctaactctggaccaggatttttcggtagacgtaaagaaatgggatttgaggaagac
attgaatctggtcccaaacggaaggttcaacgaattagtagtccagaacgctgggaatta
aaacaaatgatgtcagctggtgtgattgaaaagacagaattacctgatttcgatgaagag
actggacttttaccacgcgaagatgaagaatctgacgaagatattgaaattgaacttgtt
gaagatgaaccaccatttcttaagggtcatggtcgacatgcaatggatttgtctccagtt
agaatagtcaagaatccagacggatcattgcaacaagctgctatgatgagacaagctcta
caaaaagaaagacgtgaaatgaaacaacaagaaaggcaaaaccaagtaacagctgaacgg
gagactgctcctgaacgaatgggtaaagattggcatgatccaatggggtttacattggac
aatgaaccgcagttttcaggttcacgttcggctgaccagtttaaagatgtaccggaatgg
aaacgtgctgttcaagggggtacaagaactggagctgttggtaaaaagattgtacgctct
attcttgaacagcgtcaagctttacccatattcagactaaaagatgaattaatgaaggca
gtgaatgataataaagtattgattgttattggagaaactggtagtgggaagactacacaa
ataacacaatatttagctgaagcaggttatgttaacactggtcgcattggatgcactcaa
ccacgtcgagttgcagctatgtctgtagctaaacgagtatctgaagaatttggttgtcgt
ctagggcaagaagttggttatacaatacgttttgaagattgtactgcaccagagacaaaa
atcaagtacatgacagatggtatgctattacgtgaatgccttattgatccggacttacgc
caatattcagtaattatgttggatgaagcgcatgaaagaacaatacatacagatgtatta
tttggtttattgaaaaaggctattcaaaaacgagatgatatgaagttaattgtcacttca
gctactcttgattcagtcaaattttctcagtacttttttgaagctcctatatttactata
cccggtcgtacatatcctgttgaaatattgtatagtttagagccggaaaatgattatcta
gacgctgcactcaatacagttatgcaaattcatttaactgaacctccaggagatatttta
gtatttttaactggtcaagaagaaatcgactctggttgtgaacttctttatgaacgtatg
aaagctttaggttctgaagtacctgaattaatcattttaccagtttatgctgctttgcct
tctgaaatgcaatcgagaatttttgatcctgcacctccaggctctcgtaaagtagtgatt
gctacaaatattgctgaaacatctctaacaattgatggaatttattatgttattgatcca
ggttttgtaaaacaaaaagtgtacagtagtaaatccggtatggatcaacttattgtcaca
ccaatttcacaggctcaagctaaacaacgtgctggacgtgcaggtcgtacaggtcctgga
aaatgttatcgtttgtatactgaaagagcctacagagatgaaatgttagcgactaatgta
ccagagattcaaagaacaaatctagcaagtacagttttacagttgaaagccatgggtata
aatgatttattgtcatttgactttatggatcctcccccattacagacacttgtcgctgct
atggaaactttacatggtttatctgctctggatgatgaaggattgttgacacgtcttgga
agaaggatggctgaattccctcttgaaccaatgctttctaagatgttaattatgtcagtg
catttacaatgttctgaagaagtattaactgtcgtttcaatgctatctgttcaaaatgtt
ttctatcgtcctaaggagaaaactgaattggctgatcaacgtaaagcgaagtttcatcaa
cctgaaggtgatcatcttactctattggctgtatacaatgcatggaagaataataaattt
tctgctccatggtgttatgataattttctacaagcaagaacattaaaacgcgctcaagat
gtacgtaaacaattgcttggtattatggacagacataaacttgatgtagtttcatgcggt
aaaaagactgcattagcacagaaagcaattttgtctggattctttcgtaatgctgcaaag
aaagatccacaagaaggttatcgtactctggttgaccaacaagttgtttatattcatcca
tcatctgcattatttaatagacaaccagattgggttgtctatcatgaattagttatgact
actaaagaatatatgcgtgaagtgaccacaattgatccaagatggttagtagaatttgca
ccgaatttctttaaatttggcgatccaactaaattatcacgtactaaaaaatcaatgaga
attgaaccattatttagtaaatttgaagaaaaagattcatggcgtatttcacgtgttcca
aggaaatttcatgttaaagttacattttaa

DBGET integrated database retrieval system