KEGG   Schistosoma mansoni: Smp_161350Help
Entry
Smp_161350        CDS       T01095                                 

Definition
(RefSeq) putative succinate semialdehyde dehydrogenase
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
smm  Schistosoma mansoni
Pathway
smm00250  Alanine, aspartate and glutamate metabolism
smm00650  Butanoate metabolism
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Smp_161350
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Smp_161350
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     Smp_161350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 8352102
NCBI-ProteinID: XP_018649158
GeneDB: Smp_161350
UniProt: G4V9C8
Position
1
AA seq 552 aa AA seqDB search
MAKNLVHVPAFRYPVSISIERHCVRKWWLAKSNALRIPSAQISLSCSLMGSPSWGHLVPE
NKAFYSGKWEPSLSGKKFSVVNPATGEHLGSVPACSKNECEISVNVASVSQKEWRLKTPG
ERSSVIRKWADTIRQNVDALTDLIVAENGKSSFDARNEVLAGVSALEWYAEEAKRVFGLY
IPSLSSHSRRQLVAQQPIGVVGVITPWNFPLSMVTRKVGAALASGCSAIIKPAEDTPLTS
LAITYLGVEKAGIPPGVLNVVTAAVDDNGAEEIGNILCTHPIVRLIGFTGSTKVGTMLYT
KAANYGKRVLLEMGGNAPFIVFDSANIEKAVAGAVGCKFRCSGQTCISANRIFVHDEIHD
VFVRKLTEAVSHLHMGNGADPNINLGPVINEKALTKIEKLVNLSVEHGAHALIGGHSRLK
GKSSFGLDYSNGYFYPATVLSNCHTKMACMEEEVFGPVASVCRFKTEEEVIELANATPYG
LAGYIYTENINQAWRISDELQVGMVGLNTGFVSTIELPFGGVKNSGIGREGGPNALHEFM
DIKTITWDTSNN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaatctagtacatgtacctgcatttcgttatccagtttcaatatcgatagaa
cgacattgtgtgcgaaaatggtggctcgcgaaatcaaatgcattacgtattcccagtgca
caaataagtttatcatgcagtctgatgggatcaccatcttggggccatttagttccagaa
aacaaagcgttctattcggggaaatgggaaccttccttgtctgggaaaaagttttcggtt
gtgaatccagctacaggtgaacacttaggttcagttccagcttgttcaaagaatgaatgt
gaaattagcgtcaatgtagcttcagtcagccaaaaagaatggagattgaaaacaccgggg
gaacgatcgtcagttatacgtaaatgggcagatactattcgacagaatgttgacgcattg
acggatcttattgtagctgaaaatggaaaatcgtcattcgatgcacgtaatgaagttcta
gcaggtgtttccgctttggaatggtatgctgaggaagctaaacgtgtttttggtctttat
attccatcactaagctctcattcacggcgtcagctagttgctcaacaaccgattggcgtt
gttggtgtaattactccgtggaattttccactttctatggtaacacgaaaagttggtgct
gctttggcttcaggatgctctgcaattattaaaccagctgaagatactccattaacatca
ttggctattacttatcttggtgttgaaaaagcagggatacctccaggtgttttgaatgta
gtcacagctgcagttgatgacaatggagcagaagaaattggaaatatattatgtactcat
ccaattgttcgtttaattggatttaccggctctacaaaagtgggaacgatgttatatacc
aaagctgctaattatggtaaacgtgttcttttggaaatgggcggtaatgctccgtttatt
gtttttgattctgcaaatattgagaaagctgtcgctggtgcagtaggatgtaaatttcgt
tgttctggacaaacttgtatatcagcaaatcgtatttttgttcatgatgaaatacatgat
gtatttgttagaaaactaactgaagctgtttctcatcttcacatgggtaatggtgctgat
ccaaatatcaatttaggcccagttatcaatgaaaaagctttaactaagattgaaaaatta
gttaatctatctgtagaacatggcgcacatgcattaattggtggtcatagtagattaaag
ggtaaaagttcatttggacttgattactccaatggttatttttatccggcaactgttctg
tcgaattgtcatacaaaaatggcatgtatggaagaagaggttttcggtcctgttgcttca
gtttgcagattcaaaactgaggaagaagtgattgaattagccaatgcaacaccatacggt
ttagctggttacatttacacagagaatattaatcaagcttggagaatttcagatgaatta
caagttggaatggttggtttaaatacgggatttgtaagtactattgaattaccatttggc
ggagtgaaaaactccggaattggacgtgaaggcggaccgaatgctttacatgaatttatg
gatattaaaacaatcacttgggatacatcaaataattaa

DBGET integrated database retrieval system