KEGG   Schistosoma mansoni: Smp_168520Help
Entry
Smp_168520        CDS       T01095                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smm  Schistosoma mansoni
Pathway
smm00010  Glycolysis / Gluconeogenesis
smm00620  Pyruvate metabolism
smm00640  Propanoate metabolism
smm01100  Metabolic pathways
smm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_168520
   00620 Pyruvate metabolism
    Smp_168520
   00640 Propanoate metabolism
    Smp_168520
Enzymes [BR:smm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Smp_168520
Lipid biosynthesis proteins [BR:smm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Smp_168520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 8347065
NCBI-ProteinID: XP_018651731
GeneDB: Smp_168520
UniProt: G4VI74
Position
4
AA seq 701 aa AA seqDB search
MSIVSPSDLIRESAHVKSAEEHKLLSDKALCNPKEFWLGYAMKFHWQSPPSFGKCLSYNF
DCRKGPIFVKWFEDGCTNICYNILDRNVDRGFGDKVAILWEGNDPNDTNRLTYSEILVKV
KRIGKMLENFGIRKGDCVAIYMPMIPELLMTMLACARIGAVHTVVFGGFSACALADRIID
AKCSILITADGTWRGSKLIQLQSIASTAMDMCEEKGYSVRRCVVFQHVTAFPSKSTNGIS
NNVESKVGVRPASMLDVPLKDGRDYWWHDIISTIPENTDCPVEWVNSEDPLFILYTSGST
GRPKGVVHTTGGYMVYTATTFFYTFDYHEDDIYWCTADAGWITGHSYVVYGPLLNGATSV
VFEGIPTWPDPGRYWSIVDRYKVTKFYTAPTAIRTLIKAGDQYVQCYDRTSLKVLGSVGE
PINVSAWEWYYNIVGNGKCSIVDTFWQTETGGHMLTSLPGANIMKPGCATKPFFGIDARI
LSESGEDLTDKSKELGINVEGYLVFAKPWPGMMRTINNNYELFESVYFKRFPGYYVAGDG
SVLDKDGDFWITGRLDDMLNVSGHLISTAEVENALLLDPNVSEAAVVGRKHSVKGECLYC
FVTLKDTIPNDHMNGFMDVDIITQEMKSELCQMIRTKIGPFATPDYIQSAPVLPKTRSGK
IIRRILRKIANEDYEFGDTSTLLDYSCLETLIKLSKSVINQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtttcacctagtgatttaatcagagaatctgctcatgttaagtcagctgaa
gaacacaaattgttatctgacaaggcattatgtaatcccaaagaattttggttgggatat
gcaatgaagtttcactggcaatcacctccttcattcggaaaatgtcttagttacaatttc
gattgccgtaaaggacctattttcgttaaatggtttgaagatggatgcacaaatatttgc
tacaatatcttggatcgtaatgttgaccgtggttttggcgataaagtggcaattttatgg
gaaggtaacgatccaaatgatacaaatcgtttgacatactctgaaatattggtcaaggtc
aaaagaattgggaaaatgcttgagaatttcggtattagaaaaggagattgtgttgccatt
tatatgcctatgatcccagagcttctgatgactatgttagcatgtgctcgtattggtgct
gtacatactgttgtatttggtgggttctctgcctgtgctcttgctgatcgaattatcgat
gccaaatgtagcattcttatcactgctgatggaacatggagagggtcaaaacttattcaa
cttcaatcaattgcgtctactgcaatggatatgtgtgaagagaaaggatattctgtacga
cgatgtgttgtatttcaacatgtcaccgcttttccttctaaatccactaatggaatcagt
aataatgttgaaagtaaagttggcgttcgacccgcttcaatgcttgatgtcccattaaag
gatggtcgtgattattggtggcatgatataatcagtactattcctgaaaatactgattgt
cctgtagaatgggtgaattcagaagatccgttatttatactttatacaagtggcagtaca
ggacgaccgaaaggtgttgtacacaccacaggtggctacatggtttatacagctacaaca
ttcttctacacgttcgattatcatgaagatgatatatattggtgtactgctgatgccggt
tggataacaggtcattcatatgttgtatatggaccattattaaacggtgctacaagtgta
gtttttgaaggcattccaacttggcctgatccgggtcgatattggtctatcgtagatcga
tataaagtgacgaaattctatacagctccaacagcaattcggacgttaataaaggctggt
gatcaatacgtccaatgttatgatcgtacatcattaaaagttcttggaagtgttggtgag
ccaatcaatgtatctgcttgggaatggtattataatattgtgggtaatggtaaatgttca
attgtcgatacattttggcaaacagaaactggtggacatatgcttacatcattacctgga
gcaaatataatgaaacctggctgtgctactaaaccgttctttggcattgatgctcgaata
ttatcggaaagtggtgaagatttaacagacaagtcaaaagaactaggtatcaatgtagaa
ggttatttggtctttgctaaaccatggcctggtatgatgagaacaatcaataataattat
gaattatttgaatcagtttattttaaacgttttcctggttattatgttgctggtgacggt
tctgtgttagataaagatggagatttttggataaccggtcgtttagatgatatgttgaat
gttagcggtcatcttattagtactgcagaagtagaaaatgctcttctattagatccaaat
gttagtgaagctgctgttgtcggtcgaaaacattcagttaagggtgaatgtttatattgt
tttgttacattgaaagatactataccaaatgatcatatgaatggtttcatggatgttgat
ataattacacaagaaatgaaatcagaattatgtcaaatgatacgaacaaaaattggacca
tttgctactccagattacattcagagtgcccctgtgctaccaaaaacacgtagtggtaaa
attataagacgtattttacgaaaaatagctaatgaagattatgaattcggtgatacatca
actttattggattattcttgtttagaaactttaattaaattatcaaaatccgtcataaat
caataa

DBGET integrated database retrieval system